Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SH3PXD2A, Human (Myc, His)

SH3PXD2A is an adapter protein that plays a crucial role in the formation of invadopodia and podosomes, thereby enhancing the invasiveness of cancer cells. It interacts with ADAM, NOX and phosphoinositides and contributes to a variety of cellular processes. SH3PXD2A Protein, Human (Myc, His) is the recombinant human-derived SH3PXD2A protein, expressed by E. coli , with N-His, C-Myc labeled tag.

Product Specifications

Product Name Alternative

SH3PXD2A Protein, Human (Myc, His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sh3pxd2a-protein-human-myc-his.html

Purity

90

Smiles

PDPSGKELDTVPAKGRQNEGKSDSLEKIERRVQALNTVNQSKKATPPIPSKPPGGFGKTSGTPAVKMRNGVRQVAVRPQSVFVSP

Molecular Formula

9644 (Gene_ID) Q5TCZ1 (P902-P986) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fam122a (NM_026520) Mouse Recombinant Protein
E45M47616M5 20 µg

Fam122a (NM_026520) Mouse Recombinant Protein

Sign In for Pricing
View Details
Cadherin 16 Rabbit mAb
E45R11705N-50 50 µL

Cadherin 16 Rabbit mAb

Sign In for Pricing
View Details
4-palmitamido TEMPO
orb2283138-01 1 mg

4-palmitamido TEMPO

Sign In for Pricing
View Details
4-palmitamido TEMPO
orb2283138-02 5 mg

4-palmitamido TEMPO

Sign In for Pricing
View Details
4-palmitamido TEMPO
orb2283138-03 10 mg

4-palmitamido TEMPO

Sign In for Pricing
View Details
H-Orn (z) -OMe hydrochloride
OR964399-01 1 g

H-Orn (z) -OMe hydrochloride

Sign In for Pricing
View Details