Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TFPI2, Human (HEK293, C-His)

The critical role of the TFPI2 protein in regulating plasmin-mediated matrix remodeling suggests its involvement in extracellular matrix dynamics. It inhibits trypsin, plasmin, factor VIIa/tissue factor and weak factor Xa, affecting coagulation and fibrinolysis. TFPI2 Protein, Human (HEK293, C-His) is the recombinant human-derived TFPI2 protein, expressed by HEK293 , with C-10*His labeled tag.

Product Specifications

Product Name Alternative

TFPI2 Protein, Human (HEK293, C-His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tfpi2-protein-human-hek293-c-his.html

Purity

95.00

Smiles

DAAQEPTGNNAEICLLPLDYGPCRALLLRYYYDRYTQSCRQFLYGGCEGNANNFYTWEACDDACWRIEKVPKVCRLQVSVDDQCEGSTEKYFFNLSSMTCEKFFSGGCHRNRIENRFPDEATCMGFCAPKKIPSFCYSPKDEGLCSANVTRYYFNPRYRTCDAFTYTGCGGNDNNFVSREDCKRACAKALK

Molecular Formula

7980 (Gene_ID) P48307 (D23-K213) (Accession)

Molecular Weight

Approximately 18-32 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phenyl-2-thiazolylmethanone
OR1093634 1 Each

Phenyl-2-thiazolylmethanone

Sign In for Pricing
View Details
LOC100359536 3'UTR Luciferase Stable Cell Line
TU207223 1.0 mL

LOC100359536 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
NKD1 (Biotin)
570202-01 50 µg

NKD1 (Biotin)

Sign In for Pricing
View Details
NKD1 (Biotin)
570202-02 100 µg

NKD1 (Biotin)

Sign In for Pricing
View Details
CTLA-4 Recombinant Rabbit Monoclonal Antibody [PS01-34]
HA721269 100 µL

CTLA-4 Recombinant Rabbit Monoclonal Antibody [PS01-34]

Sign In for Pricing
View Details
Caspase-3 Fluorometric BioAssayTM Kit (CPP32) discontinued
219559 100 Tests

Caspase-3 Fluorometric BioAssayTM Kit (CPP32) discontinued

Sign In for Pricing
View Details