IL-17A, Marmoset
IL-17A is a homodimeric cytokine and plays a critical role in host defense mechanisms against many bacterial and fungal pathogens as well as allergic and autoimmune responses. IL-17A induces the production of antimicrobial peptides, cytokines, chemokines, and matrix metalloproteinases[1][2]. IL-17A Protein, Marmoset is a recombinant marmoset IL-17A protein is expressed in E. coli. It consists of 134 amino acids (I20-A153) .
Product Specifications
Product Name Alternative
IL-17A Protein, Marmoset, Marmoset, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/il-17a-protein-marmoset.html
Purity
96.0
Smiles
IVKAGIASPQNPGCPNAEDKNFPRTVMVNLNIRNRNTNSKRASDYYNRSSSPWNLHRNEDPERYPSVIWEAKCRHLGCVDADGNVDYHMNSVPIQQEILVLRREPRHCTNSFRLEKMLVSVGCTCVTPIVRHVA
Molecular Formula
100385200 (Gene_ID) A5HJM0 (I20-A153) (Accession)
Molecular Weight
Approximately 17 kDa, based on SDS-PAGE under reducing conditions.
References & Citations
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
![Rat IL-2 Recombinant Rabbit Monoclonal Antibody [PSH05-72] - BSA and Azide free (Detector)](https://cdn.genprice.uk/products/992/68dd1c90061270361ea82c62/imageurl/ha722424.webp)
Rat IL-2 Recombinant Rabbit Monoclonal Antibody [PSH05-72] - BSA and Azide free (Detector)
Uncoated Human SOD2 (Superoxide Dismutase 2, Mitochondrial) ELISA Kit
Uncoated Human SOD2 (Superoxide Dismutase 2, Mitochondrial) ELISA Kit
