Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-17A, Marmoset

IL-17A is a homodimeric cytokine and plays a critical role in host defense mechanisms against many bacterial and fungal pathogens as well as allergic and autoimmune responses. IL-17A induces the production of antimicrobial peptides, cytokines, chemokines, and matrix metalloproteinases[1][2]. IL-17A Protein, Marmoset is a recombinant marmoset IL-17A protein is expressed in E. coli. It consists of 134 amino acids (I20-A153) .

Product Specifications

Product Name Alternative

IL-17A Protein, Marmoset, Marmoset, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-17a-protein-marmoset.html

Purity

96.0

Smiles

IVKAGIASPQNPGCPNAEDKNFPRTVMVNLNIRNRNTNSKRASDYYNRSSSPWNLHRNEDPERYPSVIWEAKCRHLGCVDADGNVDYHMNSVPIQQEILVLRREPRHCTNSFRLEKMLVSVGCTCVTPIVRHVA

Molecular Formula

100385200 (Gene_ID) A5HJM0 (I20-A153) (Accession)

Molecular Weight

Approximately 17 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Chen K, et al. Interluekin-17A (IL17A) . Gene. 2017 May 30;614:8-14.|[2]Iwakura Y, et al. The roles of IL-17A in inflammatory immune responses and host defense against pathogens. Immunol Rev. 2008 Dec;226:57-79.|[3]Cua DJ, et al. Innate IL-17-producing cells: the sentinels of the immune system. Nat Rev Immunol. 2010 Jul;10 (7) :479-89.|[4]Wright JF, et al. The human IL-17F/IL-17A heterodimeric cytokine signals through the IL-17RA/IL-17RC receptor complex. J Immunol. 2008 Aug 15;181 (4) :2799-805.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CABP4 (NM_145200) Human Over-expression Lysate
LC403429 20 µg

CABP4 (NM_145200) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Human CD32a/FCGR2A Protein (H131, His Tag)
PKSH032418-01 10 µg

Recombinant Human CD32a/FCGR2A Protein (H131, His Tag)

Sign In for Pricing
View Details
Recombinant Human CD32a/FCGR2A Protein (H131, His Tag)
PKSH032418-02 50 µg

Recombinant Human CD32a/FCGR2A Protein (H131, His Tag)

Sign In for Pricing
View Details
2,4,5-Trichlorophenol-13C6
TRC-T774148-5MG 5 mg

2,4,5-Trichlorophenol-13C6

Sign In for Pricing
View Details
Human Kappa Light Chain (L1C1), Biotin conjugate, 0.1mg/mL
BNCB0018-100 1x 100 µL

Human Kappa Light Chain (L1C1), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PSMD1 Antibody
KC-1365-01 50 μL

PSMD1 Antibody

Sign In for Pricing
View Details