Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LATS1, Human (His, Myc)

LATS1 Protein, Human (His, Myc) is the recombinant human-derived LATS1 protein, expressed by E. coli, with C-Myc & N-10*His tag.

Product Specifications

Product Name Alternative

LATS1 Protein, Human (His, Myc), Human, E. coli

UNSPSC

12352202

Type

Reference compound

Assay Protocol

https://www.medchemexpress.com/cytokines/lats1-protein-human-his-myc.html

Purity

90

Smiles

FVKIKTLGIGAFGEVCLARKVDTKALYATKTLRKKDVLLRNQVAHVKAERDILAEADNEWVVRLYYSFQDKDNLYFVMDYIPGGDMMSLLIRMGIFPESLARFYIAELTCAVESVHKMGFIHRDIKPDNILIDRDGHIKLTDFGLCTGFRWTHDSKYYQSGDHPRQDSMDFSNEWGDPSSCRCGDRLKPLERRAARQHQRCLAHSLVGTPNYIAPEVLLRTGYTQLCDWWSVGVILFEMLVGQPPFLAQTPLETQMKVINWQTSLHIPPQAKLSPEASDLIIKLCRGPEDRLGKNGADEIKAHPFFKTIDFSSDLRQQSASYIPKITHPTDTSNFDPVDPDKLWSDDNEEENVNDTLNGWYKNGKHPEHAFYEFTFRRFFDDNGYP

Molecular Formula

9113 (Gene_ID) O95835-1 (F705-P1090) (Accession)

Molecular Weight

Approximately 49kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bio-Rad 25 lane comb, 1.0 mm thick
cbl25-100 1 Unit

Bio-Rad 25 lane comb, 1.0 mm thick

Sign In for Pricing
View Details
Syntaxin-binding protein 1 (STXBP1) Bovine ELISA Kit
H4172 96 Tests

Syntaxin-binding protein 1 (STXBP1) Bovine ELISA Kit

Sign In for Pricing
View Details
Pycr1 3'UTR GFP Stable Cell Line
TU167345 1.0 mL

Pycr1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Zona pellucida sperm-binding protein 3 (ZP3) Rabbit ELISA Kit
I4273 96 Tests

Zona pellucida sperm-binding protein 3 (ZP3) Rabbit ELISA Kit

Sign In for Pricing
View Details
Anti-POMT1 Antibody
STJ502579 100 µg

Anti-POMT1 Antibody

Sign In for Pricing
View Details
Embigin (EMB) Antibody
abx318809-01 20 µg

Embigin (EMB) Antibody

Sign In for Pricing
View Details