Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-3R alpha/CD123, Mouse (HEK293, His)

IL-3R alpha/CD123 protein, a receptor for IL3, is expressed on hematopoietic cells and governs their production and differentiation. Upon ligand binding, it heterodimerizes with IL3RB, activating JAK2 and PI3K. This activation leads to cell proliferation and differentiation, mediated by STAT5. IL-3R alpha interacts with IL3 and forms heterodimers with alpha and beta subunits, contributing to hematopoietic cell development. IL-3R alpha/CD123 Protein, Mouse (HEK293, His) is the recombinant mouse-derived IL-3R alpha/CD123 protein, expressed by HEK293 , with C-8*His labeled tag.

Product Specifications

Product Name Alternative

IL-3R alpha/CD123 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-3r-alpha-cd123-protein-mouse-hek-293-his.html

Smiles

SDLAAVREAPPTAVTTPIQNLHIDPAHYTLSWDPAPGADITTGAFCRKGRDIFVWADPGLARCSFQSLSLCHVTNFTVFLGKDRAVAGSIQFPPDDDGDHEAAAQDLRCWVHEGQLSCQWERGPKATGDVHYRMFWRDVRLGPAHNRECPHYHSLDVNTAGPAPHGGHEGCTLDLDTVLGSTPNSPDLVPQVTITVNGSGRAGPVPCMDNTVDLQRAEVLAPPTLTVECNGSEAHARWVARNRFHHGLLGYTLQVNQSSRSEPQEYNVSIPHFWVPNAGAISFRVKSRSEVYPRKLSSWSEAWGLVCPPEVMPVK

Molecular Formula

16188 (Gene_ID) P26952-1 (S17-K331) (Accession)

Molecular Weight

Approximately 50-65 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

GTSF1 Rabbit pAb
A18534-01 20 µL

GTSF1 Rabbit pAb

Sign In for Pricing
View Details
GTSF1 Rabbit pAb
A18534-02 100 μL

GTSF1 Rabbit pAb

Sign In for Pricing
View Details
GTSF1 Rabbit pAb
A18534-03 500 μL

GTSF1 Rabbit pAb

Sign In for Pricing
View Details
GTSF1 Rabbit pAb
A18534-04 1000 μL

GTSF1 Rabbit pAb

Sign In for Pricing
View Details
Human Telomerase (TE) ELISA Kit
MBS282932-01 48 Tests

Human Telomerase (TE) ELISA Kit

Sign In for Pricing
View Details
Human Telomerase (TE) ELISA Kit
MBS282932-02 96 Tests

Human Telomerase (TE) ELISA Kit

Sign In for Pricing
View Details