Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-3R alpha/CD123, Mouse (HEK293, His)

IL-3R alpha/CD123 protein, a receptor for IL3, is expressed on hematopoietic cells and governs their production and differentiation. Upon ligand binding, it heterodimerizes with IL3RB, activating JAK2 and PI3K. This activation leads to cell proliferation and differentiation, mediated by STAT5. IL-3R alpha interacts with IL3 and forms heterodimers with alpha and beta subunits, contributing to hematopoietic cell development. IL-3R alpha/CD123 Protein, Mouse (HEK293, His) is the recombinant mouse-derived IL-3R alpha/CD123 protein, expressed by HEK293 , with C-8*His labeled tag.

Product Specifications

Product Name Alternative

IL-3R alpha/CD123 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-3r-alpha-cd123-protein-mouse-hek-293-his.html

Smiles

SDLAAVREAPPTAVTTPIQNLHIDPAHYTLSWDPAPGADITTGAFCRKGRDIFVWADPGLARCSFQSLSLCHVTNFTVFLGKDRAVAGSIQFPPDDDGDHEAAAQDLRCWVHEGQLSCQWERGPKATGDVHYRMFWRDVRLGPAHNRECPHYHSLDVNTAGPAPHGGHEGCTLDLDTVLGSTPNSPDLVPQVTITVNGSGRAGPVPCMDNTVDLQRAEVLAPPTLTVECNGSEAHARWVARNRFHHGLLGYTLQVNQSSRSEPQEYNVSIPHFWVPNAGAISFRVKSRSEVYPRKLSSWSEAWGLVCPPEVMPVK

Molecular Formula

16188 (Gene_ID) P26952-1 (S17-K331) (Accession)

Molecular Weight

Approximately 50-65 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

C3c Human Complement Proteins
A116 250 µg/Vial

C3c Human Complement Proteins

Sign In for Pricing
View Details
Mouse Monoclonal Resistin Antibody (HRES106) [DyLight 550]
NBP3-11678R 0.1 mL

Mouse Monoclonal Resistin Antibody (HRES106) [DyLight 550]

Sign In for Pricing
View Details
Lentiviral human CD93 sgRNA gene knockout kit - Lentiviral human CD93 sgRNA gene knockout kit (plasmid)
GTR15393362 1 Vial

Lentiviral human CD93 sgRNA gene knockout kit - Lentiviral human CD93 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
Mouse Monoclonal IkB-beta Antibody (2B11)
H00004793-M02 0.1 mg

Mouse Monoclonal IkB-beta Antibody (2B11)

Sign In for Pricing
View Details
ZNF700 siRNA Oligos set (Human)
51741171 3x 5 nmol

ZNF700 siRNA Oligos set (Human)

Sign In for Pricing
View Details
Frozen Tissue Sections, Cecum
CS506129 5x 5 µm

Frozen Tissue Sections, Cecum

Sign In for Pricing
View Details