B7-2/CD86, Human (HEK293, His)
B7-2/CD86 protein negatively regulates T-cell activation by disrupting CD86 cluster formation, modulating the T-cell response, and influencing immune activation. B7-2/CD86 Protein, Human (HEK293, His) is the recombinant human-derived B7-2/CD86 protein, expressed by HEK293 , with C-6*His labeled tag.
Product Specifications
Product Name Alternative
B7-2/CD86 Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/cd86-protein-human-hek-293-his.html
Purity
95.0
Smiles
APLKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKEKFDSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGMIRIHQMNSELSVLANFSQPEIVPISNITENVYINLTCSSIHGYPEPKKMSVLLRTKNSTIEYDGVMQKSQDNVTELYDVSISLSVSFPDVTSNMTIFCILETDKTRLLSSPFSIELEDPQPPPDHIP
Molecular Formula
942 (Gene_ID) AAH40261.1 (A24-P247) (Accession)
Molecular Weight
57-66 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC880017-100 1x 100 µL
Ep-CAM / CD326 (VU-1D9), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740177-500 1x 500 µL
CD50 (ICAM-3) (101-1D2), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470780-100 1x 100 µL
HSP60 (HSPD1/780), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680803-100 1x 100 µL
Cytokeratin 8 (KRT8/803), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740523-500 1x 500 µL
AFP (Alpha Fetoprotein) (C2), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details