B7-2/CD86, Human (HEK293, His)
B7-2/CD86 protein negatively regulates T-cell activation by disrupting CD86 cluster formation, modulating the T-cell response, and influencing immune activation. B7-2/CD86 Protein, Human (HEK293, His) is the recombinant human-derived B7-2/CD86 protein, expressed by HEK293 , with C-6*His labeled tag.
Product Specifications
Product Name Alternative
B7-2/CD86 Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/cd86-protein-human-hek-293-his.html
Purity
95.0
Smiles
APLKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKEKFDSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGMIRIHQMNSELSVLANFSQPEIVPISNITENVYINLTCSSIHGYPEPKKMSVLLRTKNSTIEYDGVMQKSQDNVTELYDVSISLSVSFPDVTSNMTIFCILETDKTRLLSSPFSIELEDPQPPPDHIP
Molecular Formula
942 (Gene_ID) AAH40261.1 (A24-P247) (Accession)
Molecular Weight
57-66 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
CB555-C8-X (2) 5 µm
Caprisil C8-X (2) HPLC Column, 5 µm, 100 Å, CB555-C8-X (2) x 100 mm
Sign In for Pricing
View Details 055311-01 10 µg
Acylglycerol Kinase (AGK), Recombinant, Human, His-Tag, GST-Tag
Sign In for Pricing
View Details 055311-02 50 µg
Acylglycerol Kinase (AGK), Recombinant, Human, His-Tag, GST-Tag
Sign In for Pricing
View Details 055311-03 100 µg
Acylglycerol Kinase (AGK), Recombinant, Human, His-Tag, GST-Tag
Sign In for Pricing
View Details 055311-04 200 µg
Acylglycerol Kinase (AGK), Recombinant, Human, His-Tag, GST-Tag
Sign In for Pricing
View Details 