Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAGOH, Human (His)

MAGOH is an important spliceosome component that cooperates with MAGOHB to form the exon junction complex (EJC), which is central to pre-mRNA splicing and nonsense-mediated decay (NMD) . EJC affects mRNA metabolism, marks exon-exon junctions, and affects processes such as mRNA export, localization, translation, and NMD. MAGOH Protein, Human (His) is the recombinant human-derived MAGOH protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

MAGOH Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/magoh-protein-human-his.html

Purity

96.00

Smiles

MESDFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKNDVMIRKEAYVHKSVMEELKRIIDDSEITKEDDALWPPPDRVGRQELEIVIGDEHISFTTSKIGSLIDVNQSKDPEGLRVFYYLVQDLKCLVFSLIGLHFKIKPI

Molecular Formula

4116 (Gene_ID) P61326-1/NP_002361.1 (M1-I146) (Accession)

Molecular Weight

Approximately 17 kDa.

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC34A2, Human (HEK293, Fc)
HY-P705441 1 Each

SLC34A2, Human (HEK293, Fc)

Sign In for Pricing
View Details
Plakophilin 1 Polyclonal Antibody
orb1416966 100 µL

Plakophilin 1 Polyclonal Antibody

Sign In for Pricing
View Details
SMCR9 3'UTR GFP Stable Cell Line
TU073734 1.0 mL

SMCR9 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
LHFPL3 Recombinant Protein (Mouse)
RP147377 100 µg

LHFPL3 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
KLK7 Human, sf9
PT-A03188-01 1 µg

KLK7 Human, sf9

Sign In for Pricing
View Details
KLK7 Human, sf9
PT-A03188-02 5 µg

KLK7 Human, sf9

Sign In for Pricing
View Details