Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAGOH, Human (His)

MAGOH is an important spliceosome component that cooperates with MAGOHB to form the exon junction complex (EJC), which is central to pre-mRNA splicing and nonsense-mediated decay (NMD) . EJC affects mRNA metabolism, marks exon-exon junctions, and affects processes such as mRNA export, localization, translation, and NMD. MAGOH Protein, Human (His) is the recombinant human-derived MAGOH protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

MAGOH Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/magoh-protein-human-his.html

Purity

96.00

Smiles

MESDFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKNDVMIRKEAYVHKSVMEELKRIIDDSEITKEDDALWPPPDRVGRQELEIVIGDEHISFTTSKIGSLIDVNQSKDPEGLRVFYYLVQDLKCLVFSLIGLHFKIKPI

Molecular Formula

4116 (Gene_ID) P61326-1/NP_002361.1 (M1-I146) (Accession)

Molecular Weight

Approximately 17 kDa.

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal NFkB1/NFkB p105 Antibody [Alexa Fluor 750]
NBP1-77395AF750 0.1 mL

Rabbit Polyclonal NFkB1/NFkB p105 Antibody [Alexa Fluor 750]

Sign In for Pricing
View Details
FRA2K AAV siRNA Pooled Vector
20883161 1.0 µg

FRA2K AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Enc1 Mouse qPCR Primer Pair (NM_007930)
MP204069 200 Reactions

Enc1 Mouse qPCR Primer Pair (NM_007930)

Sign In for Pricing
View Details
Clostridium chauvoei Probe-based qPCR Kit
MK1F279-01 48 Test

Clostridium chauvoei Probe-based qPCR Kit

Sign In for Pricing
View Details
Clostridium chauvoei Probe-based qPCR Kit
MK1F279-02 50 Tests

Clostridium chauvoei Probe-based qPCR Kit

Sign In for Pricing
View Details
Hamster Fibroblast Growth Factor 7 ELISA Kit
MBS036977-01 48 Well

Hamster Fibroblast Growth Factor 7 ELISA Kit

Sign In for Pricing
View Details