Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAGOH, Human (His)

MAGOH is an important spliceosome component that cooperates with MAGOHB to form the exon junction complex (EJC), which is central to pre-mRNA splicing and nonsense-mediated decay (NMD) . EJC affects mRNA metabolism, marks exon-exon junctions, and affects processes such as mRNA export, localization, translation, and NMD. MAGOH Protein, Human (His) is the recombinant human-derived MAGOH protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

MAGOH Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/magoh-protein-human-his.html

Purity

96.00

Smiles

MESDFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKNDVMIRKEAYVHKSVMEELKRIIDDSEITKEDDALWPPPDRVGRQELEIVIGDEHISFTTSKIGSLIDVNQSKDPEGLRVFYYLVQDLKCLVFSLIGLHFKIKPI

Molecular Formula

4116 (Gene_ID) P61326-1/NP_002361.1 (M1-I146) (Accession)

Molecular Weight

Approximately 17 kDa.

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GRK6 (G Protein-coupled Receptor Kinase 6, FLJ32135, GPRK6) (MaxLight 405)
MBS6194147-01 0.1 mL

GRK6 (G Protein-coupled Receptor Kinase 6, FLJ32135, GPRK6) (MaxLight 405)

Sign In for Pricing
View Details
GRK6 (G Protein-coupled Receptor Kinase 6, FLJ32135, GPRK6) (MaxLight 405)
MBS6194147-02 5x 0.1 mL

GRK6 (G Protein-coupled Receptor Kinase 6, FLJ32135, GPRK6) (MaxLight 405)

Sign In for Pricing
View Details
Tgif1 (NM_001164076) Mouse Tagged Lenti ORF Clone
MR223245L4 10 µg

Tgif1 (NM_001164076) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
GLMN Human shRNA Plasmid Kit (Locus ID 11146)
TL316962 1 Kit

GLMN Human shRNA Plasmid Kit (Locus ID 11146)

Sign In for Pricing
View Details
Rabbit anti-Human FKBP1B Polyclonal Antibody
MBS7137186-01 0.05 mL

Rabbit anti-Human FKBP1B Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit anti-Human FKBP1B Polyclonal Antibody
MBS7137186-02 0.1 mL

Rabbit anti-Human FKBP1B Polyclonal Antibody

Sign In for Pricing
View Details