Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bcl-2-like 11, Human (His)

Bcl-2-like protein 11 (BCL2L11), despite its classification, does not interact with humanin. This unique feature distinguishes BCL2L11 from expected protein-protein interactions typically associated with Bcl-2 family members. Bcl-2-like Protein 11 Protein, Human (His) is the recombinant human-derived Bcl-2-like Protein 11 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Bcl-2-like Protein 11 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/bcl-2-like-protein-11-protein-human-180a-a-n-his.html

Purity

95.00

Smiles

MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPR

Molecular Formula

10018 (Gene_ID) O43521-1 (M1-R180) (Accession)

Molecular Weight

Approximately 25 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tyrosinase (T311), CF647 conjugate, 0.1mg/mL
BNC470012-100 1x 100 µL

Tyrosinase (T311), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF594 conjugate, 0.1mg/mL
BNC940391-500 1x 500 µL

CD81 / TAPA-1 (1.3.3.22), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF405M conjugate, 0.1mg/mL
BNC050391-500 1x 500 µL

CD81 / TAPA-1 (1.3.3.22), CF405M conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF568 conjugate, 0.1mg/mL
BNC680017-500 1x 500 µL

Ep-CAM / CD326 (VU-1D9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GAD1 / GAD67 (GABAergic Neuronal Marker) (GAD1/2563), CF640R conjugate, 0.1mg/mL
BNC402563-100 1x 100 µL

GAD1 / GAD67 (GABAergic Neuronal Marker) (GAD1/2563), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP60 (HSPD1/780), CF594 conjugate, 0.1mg/mL
BNC940780-100 1x 100 µL

HSP60 (HSPD1/780), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details