Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bcl-2-like 11, Human (His)

Bcl-2-like protein 11 (BCL2L11), despite its classification, does not interact with humanin. This unique feature distinguishes BCL2L11 from expected protein-protein interactions typically associated with Bcl-2 family members. Bcl-2-like Protein 11 Protein, Human (His) is the recombinant human-derived Bcl-2-like Protein 11 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Bcl-2-like Protein 11 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/bcl-2-like-protein-11-protein-human-180a-a-n-his.html

Purity

95.00

Smiles

MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPR

Molecular Formula

10018 (Gene_ID) O43521-1 (M1-R180) (Accession)

Molecular Weight

Approximately 25 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Apolipoprotein B (Apo B) (FITC)
MBS6127869-01 0.1 mL

Apolipoprotein B (Apo B) (FITC)

Sign In for Pricing
View Details
Apolipoprotein B (Apo B) (FITC)
MBS6127869-02 5x 0.1 mL

Apolipoprotein B (Apo B) (FITC)

Sign In for Pricing
View Details
Iscu (NM_025526) Mouse Tagged Lenti ORF Clone
MR201379L3 10 µg

Iscu (NM_025526) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
ARHGEF18 Polyclonal Antibody, AbBy Fluor™ 555 Conjugated
bs-7144R-BF555 100 µL

ARHGEF18 Polyclonal Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
C9orf125 Protein Vector (Human) (pPB-N-His)
PV006974 500 ng

C9orf125 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
POLR3G CRISPRa sgRNA lentivector (set of three targets)(Rat)
37197126 3x 1.0µg DNA

POLR3G CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details