Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STC2/Stanniocalcin-2, Mouse

The STC2/Stanniocalcin-2 protein exerts anti-hypocalcemia effects and is actively involved in the regulation of calcium and phosphate homeostasis.Its role in maintaining the balance of these essential minerals emphasizes its importance in physiological processes related to mineral metabolism.STC2/Stanniocalcin-2 Protein, Mouse is the recombinant mouse-derived STC2/Stanniocalcin-2 protein, expressed by E.coli , with tag free.

Product Specifications

Product Name Alternative

STC2/Stanniocalcin-2 Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/stanniocalcin-2-stc2-protein-mouse.html

Purity

98.00

Smiles

TDSTNPPEGPQDRSSQQKGRLSLQNTAEIQHCLVNAGDVGCGVFECFENNSCEIQGLHGICMTFLHNAGKFDAQGKSFIKDALRCKAHALRHKFGCISRKCPAIREMVFQLQRECYLKHDLCSAAQENVGVIVEMIHFKDLLLHEPYVDLVNLLLTCGEDVKEAVTRSVQAQCEQSWGGLCSILSFCTSNIQRPPTAAPEHQPLADRAQLSRPHHRDTDHHLTANRGAKGERGSKSHPNAHARGRTGGQSAQGPSGSSEWEDEQSEYSDIRR

Molecular Formula

20856 (Gene_ID) O88452 (T25-R296) (Accession)

Molecular Weight

Approximately 34 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Arrdc5 (NM_029799) AAV Particle
MR219841A1V 250 µL

Mouse Arrdc5 (NM_029799) AAV Particle

Sign In for Pricing
View Details
SRPX (NM_006307) Human Tagged ORF Clone Lentiviral Particle
RC204681L3V 200 µL

SRPX (NM_006307) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
ML-252 hydrochloride
T85299-01 10 mg

ML-252 hydrochloride

Sign In for Pricing
View Details
ML-252 hydrochloride
T85299-02 50 mg

ML-252 hydrochloride

Sign In for Pricing
View Details
Lentiviral mouse Aplp2 shRNA (UAS) - Lentiviral mouse Aplp2 shRNA (UAS, iRFP) (25)
GTR15273134 1 Vial

Lentiviral mouse Aplp2 shRNA (UAS) - Lentiviral mouse Aplp2 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Recombinant Pectobacterium carotovorum subsp. carotovorum UPF0208 membrane protein PC1_2779 (PC1_2779)
orb2931706-01 20 µg

Recombinant Pectobacterium carotovorum subsp. carotovorum UPF0208 membrane protein PC1_2779 (PC1_2779)

Sign In for Pricing
View Details