What is the catalog number for MCP-3/CCL7, Mouse?

The catalog number for MCP-3/CCL7, Mouse is HY-P7243.

What sizes are available for MCP-3/CCL7, Mouse?

MCP-3/CCL7, Mouse is available in the following size(s): 2 µg, 10 µg, 50 µg, 100 µg.

How many pack sizes does MCP-3/CCL7, Mouse come in?

MCP-3/CCL7, Mouse is available in 4 different pack sizes.

Is MCP-3/CCL7, Mouse in stock?

MCP-3/CCL7, Mouse is currently made to order / not held in immediate stock. Contact us for lead time.

Who manufactures MCP-3/CCL7, Mouse?

MCP-3/CCL7, Mouse is manufactured by QuantiMol.

What is the estimated delivery time for MCP-3/CCL7, Mouse?

Estimated delivery time for MCP-3/CCL7, Mouse is approximately 15 business day(s), depending on your location.

MCP-3/CCL7, Mouse

MCP-3/CCL7 Protein, Mouse is a CC chemokine and elicitor that binds to CCR1, CCR2 and CCR3 to mediate antiviral, antibacterial, antitumor and other immune responses. MCP-3/CCL7 Protein, Mouse is a recombinant mouse MCP-3/CCL7 protein expressed by E.coilMCP-3/CCL7 (Q24-P97) [1].

Product Specifications

Product Name Alternative

MCP-3/CCL7 Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mcp-3-ccl7-protein-mouse.html

Purity

97.00

Smiles

QPDGPNASTCCYVKKQKIPKRNLKSYRRITSSRCPWEAVIFKTKKGMEVCAEAHQKWVEEAIAYLDMKTPTPKP

Molecular Formula

20306 (Gene_ID) Q03366 (Q24-P97) (Accession)

Molecular Weight

Approximately 12 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]G Opdenakker, et al. The human MCP-3 gene (SCYA7) : cloning, sequence analysis, and assignment to the C-C chemokine gene cluster on chromosome 17q11.2-q12. Genomics. 1994 May 15;21 (2) :403-8.|[2]F Fioretti, et al. Reduced tumorigenicity and augmented leukocyte infiltration after monocyte chemotactic protein-3 (MCP-3) gene transfer: perivascular accumulation of dendritic cells in peritumoral tissue and neutrophil recruitment within the tumor. J Immunol. 1998 Jul 1;161 (1) :342-6.|[3]Shigero Tamba, et al. Timely interaction between prostaglandin and chemokine signaling is a prerequisite for successful fertilization. Proc Natl Acad Sci U S A. 2008 Sep 23;105 (38) :14539-44.