Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MCP-3/CCL7, Mouse

MCP-3/CCL7 Protein, Mouse is a CC chemokine and elicitor that binds to CCR1, CCR2 and CCR3 to mediate antiviral, antibacterial, antitumor and other immune responses. MCP-3/CCL7 Protein, Mouse is a recombinant mouse MCP-3/CCL7 protein expressed by E.coilMCP-3/CCL7 (Q24-P97) [1].

Product Specifications

Product Name Alternative

MCP-3/CCL7 Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mcp-3-ccl7-protein-mouse.html

Purity

97.00

Smiles

QPDGPNASTCCYVKKQKIPKRNLKSYRRITSSRCPWEAVIFKTKKGMEVCAEAHQKWVEEAIAYLDMKTPTPKP

Molecular Formula

20306 (Gene_ID) Q03366 (Q24-P97) (Accession)

Molecular Weight

Approximately 12 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]G Opdenakker, et al. The human MCP-3 gene (SCYA7) : cloning, sequence analysis, and assignment to the C-C chemokine gene cluster on chromosome 17q11.2-q12. Genomics. 1994 May 15;21 (2) :403-8.|[2]F Fioretti, et al. Reduced tumorigenicity and augmented leukocyte infiltration after monocyte chemotactic protein-3 (MCP-3) gene transfer: perivascular accumulation of dendritic cells in peritumoral tissue and neutrophil recruitment within the tumor. J Immunol. 1998 Jul 1;161 (1) :342-6.|[3]Shigero Tamba, et al. Timely interaction between prostaglandin and chemokine signaling is a prerequisite for successful fertilization. Proc Natl Acad Sci U S A. 2008 Sep 23;105 (38) :14539-44.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dehydroabietic acid
sc-499572 100 mg

Dehydroabietic acid

Sign In for Pricing
View Details
Mouse Monoclonal AKT3 Antibody (OTI9B2) [DyLight 405]
NBP2-71528V 0.1 mL

Mouse Monoclonal AKT3 Antibody (OTI9B2) [DyLight 405]

Sign In for Pricing
View Details
TRIM40 3'UTR GFP Stable Cell Line
TU076549 1.0 mL

TRIM40 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Shox2 (NM_013665) Mouse Tagged ORF Clone Lentiviral Particle
MR223575L2V 200 µL

Shox2 (NM_013665) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
TRGJ2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV788606 1.0 µg DNA

TRGJ2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
LOC682033 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV642783 1.0 µg DNA

LOC682033 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details