Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FOXM1, Human (His, SUMO-Myc)

FOXM1 is an important transcription factor that controls cell cycle gene expression critical for DNA replication and mitosis, underscoring its critical role in cellular processes. In addition to cell proliferation, FOXM1 contributes to DNA break repair and DNA damage checkpoint responses. FOXM1 Protein, Human (His, SUMO-Myc) is the recombinant human-derived FOXM1 protein, expressed by E. coli , with N-10*His, C-Myc, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

FOXM1 Protein, Human (His, SUMO-Myc), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/foxm1-protein-human-his-sumo-myc.html

Purity

90.0

Smiles

ERPPYSYMAMIQFAINSTERKRMTLKDIYTWIEDHFPYFKHIAKPGWKNSIRHNLSLHDMFVRETSANGKVSFWTIHPSANRYLTLDQVFKPL

Molecular Formula

2305 (Gene_ID) Q08050-1 (E235-L327) (Accession)

Molecular Weight

Approximately 31.2 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FRA16B AAV siRNA Pooled Vector
20845161 1.0 µg

FRA16B AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Phospho-Munc18-1 (Thr574) Rabbit Polyclonal Antibody
orb1816977-01 50 µL

Phospho-Munc18-1 (Thr574) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Phospho-Munc18-1 (Thr574) Rabbit Polyclonal Antibody
orb1816977-02 100 µL

Phospho-Munc18-1 (Thr574) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Phospho-Munc18-1 (Thr574) Rabbit Polyclonal Antibody
orb1816977-03 200 µL

Phospho-Munc18-1 (Thr574) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
VAP1, ID (Membrane Primary Amine Oxidase, Copper Amine Oxidase, Semicarbazide-sensitive Amine Oxidase, SSAO, Vascular Adhesion Protein 1, VAP-1, HPAO, AOC3) (MaxLight 650) discontinued
V2095-03A-ML650 100 µL

VAP1, ID (Membrane Primary Amine Oxidase, Copper Amine Oxidase, Semicarbazide-sensitive Amine Oxidase, SSAO, Vascular Adhesion Protein 1, VAP-1, HPAO, AOC3) (MaxLight 650) discontinued

Sign In for Pricing
View Details
SPATA19 ORF Vector (Human) (pORF)
45218011 1.0 µg DNA

SPATA19 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details