CD14, Mouse (HEK293, His-Fc)
CD14 protein is a key protein in the innate immune response and is significantly expressed in monocytes/macrophages. It acts as a coreceptor that binds various microbial and fungal molecules, including lipopolysaccharide (LPS) . CD14 Protein, Mouse (HEK293, His-Fc) is the recombinant mouse-derived CD14 protein, expressed by HEK293 , with C-hFc, C-His, C-6*His labeled tag.
Product Specifications
Product Name Alternative
CD14 Protein, Mouse (HEK293, His-Fc), Mouse, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/cd14-protein-mouse-hek293-his-fc.html
Purity
95.0
Smiles
SPAPPEPCELDEESCSCNFSDPKPDWSSAFNCLGAADVELYGGGRSLEYLLKRVDTEADLGQFTDIIKSLSLKRLTVRAARIPSRILFGALRVLGISGLQELTLENLEVTGTAPPPLLEATGPDLNILNLRNVSWATRDAWLAELQQWLKPGLKVLSIAQAHSLNFSCEQVRVFPALSTLDLSDNPELGERGLISALCPLKFPTLQVLALRNAGMETPSGVCSALAAARVQLQGLDLSHNSLRDAAGAPSCDWPSQLNSLNLSFTGLKQVPKGLPAKLSVLDLSYNRLDRNPSPDELPQVGNLSLKGNPFLDSESHSEKFNSGVVTAGAP
Molecular Formula
12475 (Gene_ID) P10810/NP_033971.1 (S16-P345) (Accession)
Molecular Weight
85-95 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC400009-500 1x 500 µL
MART-1 / Melan-A (M2-7C10), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040003-500 1x 500 µL
CD45RO (UCHL-1), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC471820-500 1x 500 µL
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940029-500 1x 500 µL
Fibronectin (TV-1), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880970-100 1x 100 µL
GLG1 (Golgi Complex) (GLG1/970), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400262-500 1x 500 µL
Human Lambda Light Chain (HP6054), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details