Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

M-CSF, Rat (HEK293)

The M-CSF protein regulates hematopoietic precursor cells, promoting their survival, proliferation, and differentiation. M-CSF Protein, Rat (HEK293) is the recombinant rat-derived M-CSF protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

M-CSF Protein, Rat (HEK293), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/m-csf-protein-rat-hek-293.html

Purity

98.0

Smiles

EVSEHCSHMIGNGHLQILQQLIDSQMETACLIEYKFVDQEQLDDPVCYLKKAFVLVQVIIEETMRFKDNTPNANATERLQELSMKLNSCFIKDYKEQNEACVQTYKESPLRLLEKIKNFFNETKNFLEKDWNIFSKNCNDSFAKCSSRDVVTKPDCNCLYPKATPSSDLASASPHQPPAPSMAPLADLAWDDSQRTEGSSLLPSDLPLRIEDPGSAKQRPPR

Molecular Formula

78965 (Gene_ID) Q8JZQ0-1 (E33-R254) (Accession)

Molecular Weight

Approximately 46.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tdpoz5 (NM_207273) Mouse Tagged ORF Clone Lentiviral Particle
MR222859L4V 200 µL

Tdpoz5 (NM_207273) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
LRFN1 Antibody
MBS9406662-01 0.1 mL

LRFN1 Antibody

Sign In for Pricing
View Details
LRFN1 Antibody
MBS9406662-02 5x 0.1 mL

LRFN1 Antibody

Sign In for Pricing
View Details
Claudin 17 Rabbit Polyclonal Antibody (Biotin)
orb456314 100 µL

Claudin 17 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
CNIH3 (NM_152495) Human 3' UTR Clone
SC213055 10 µg

CNIH3 (NM_152495) Human 3' UTR Clone

Sign In for Pricing
View Details
Anti-Caldesmon(smooth) antibody (monoclonal)
MBS175035-01 0.1 mg

Anti-Caldesmon(smooth) antibody (monoclonal)

Sign In for Pricing
View Details