Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

M-CSF, Rat (HEK293)

The M-CSF protein regulates hematopoietic precursor cells, promoting their survival, proliferation, and differentiation. M-CSF Protein, Rat (HEK293) is the recombinant rat-derived M-CSF protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

M-CSF Protein, Rat (HEK293), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/m-csf-protein-rat-hek-293.html

Purity

98.0

Smiles

EVSEHCSHMIGNGHLQILQQLIDSQMETACLIEYKFVDQEQLDDPVCYLKKAFVLVQVIIEETMRFKDNTPNANATERLQELSMKLNSCFIKDYKEQNEACVQTYKESPLRLLEKIKNFFNETKNFLEKDWNIFSKNCNDSFAKCSSRDVVTKPDCNCLYPKATPSSDLASASPHQPPAPSMAPLADLAWDDSQRTEGSSLLPSDLPLRIEDPGSAKQRPPR

Molecular Formula

78965 (Gene_ID) Q8JZQ0-1 (E33-R254) (Accession)

Molecular Weight

Approximately 46.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Radix Asteris Extract
E3898-5mg 5 mg

Radix Asteris Extract

Sign In for Pricing
View Details
Olfr701 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
33375114 3x 1.0 µg

Olfr701 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Chloride Channel 5 Polyclonal Antibody, AbBy Fluor™ 555 Conjugated
bs-10307R-BF555 100 µL

Chloride Channel 5 Polyclonal Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
Rno-miR-501-3p inhibitor
HY-RI04499-01 5 nmol

Rno-miR-501-3p inhibitor

Sign In for Pricing
View Details
Rno-miR-501-3p inhibitor
HY-RI04499-02 20 nmol

Rno-miR-501-3p inhibitor

Sign In for Pricing
View Details
PI3KR1 (N-term L11) Rabbit pAb
E2616559 100 µL

PI3KR1 (N-term L11) Rabbit pAb

Sign In for Pricing
View Details