Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Conus marmoreus Mu-conotoxin MrVIB

Product Specifications

Product Name Alternative

(CGX-1002)

Abbreviation

Recombinant Conus marmoreus Mu-conotoxin MrVIB protein

UniProt

Q26443

Expression Region

52-82aa

Organism

Conus marmoreus (Marble cone)

Target Sequence

ACSKKWEYCIVPILGFVYCCPGLICGPFVCV

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

MuO-conotoxins are gating-modifier toxins that inhibit sodium current by trapping the domain II voltage sensor in the closed position to prevent opening of the sodium channel. This toxin has a preference for Nav1.4/SCN4A over Nav1.2/SCN2A sodium channels. It blocks Nav channels by interacting mainly with the C-terminal part of the pore loop of domain-3. It also blocks fast-inactivating calcium current. Blocks Nav1.8/SCN10A sodium channels and has potent and long-lasting local anesthetic effects. It can also block propagation of action potentials in A- and C-fibers in sciatic nerve as well as skeletal muscle in isolated preparations.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

30.3 kDa

References & Citations

"Synthetic muO-conotoxin MrVIB blocks TTX-resistant sodium channel NaV1.8 and has a long-lasting analgesic activity." Bulaj G., Zhang M.M., Green B.R., Fiedler B., Layer R.T., Wei S., Nielsen J.S., Low S.J., Klein B.D., Wagstaff J.D., Chicoine L., Harty T.P., Terlau H., Yoshikami D., Olivera B.M. Biochemistry 45:7404-7414 (2006)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human SLC9C2 knockout cell line
ABC-KH14215 1 Vial

Human SLC9C2 knockout cell line

Ask
View Details
XRCC6BP1 (ATP23) (NM_033276) Human Tagged Lenti ORF Clone
RC203623L4 10 µg

XRCC6BP1 (ATP23) (NM_033276) Human Tagged Lenti ORF Clone

Ask
View Details
GSTO2 Mouse Monoclonal Antibody [Clone ID: OTI4G1]
TA503677S 30 µL

GSTO2 Mouse Monoclonal Antibody [Clone ID: OTI4G1]

Ask
View Details
Feline IgG F(ab)2 Isotype Control [HRP]
NBP1-97152 1 mg

Feline IgG F(ab)2 Isotype Control [HRP]

Ask
View Details
Lentiviral human ATP6V0E2 shRNA (UAS) - Lentiviral human ATP6V0E2 shRNA (UAS) (100)
GTR15321753 1 Vial

Lentiviral human ATP6V0E2 shRNA (UAS) - Lentiviral human ATP6V0E2 shRNA (UAS) (100)

Ask
View Details
BUBR1 (8G1) Alexa Fluor® 546
sc-47744 AF546 200 µg/mL

BUBR1 (8G1) Alexa Fluor® 546

Ask
View Details