Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cytokine receptor-like factor 1 (CRLF1)

Product Specifications

Product Name Alternative

Cytokine-like factor 1

Abbreviation

Recombinant Human CRLF1 protein

Gene Name

CRLF1

UniProt

O75462

Expression Region

38-422aa

Organism

Homo sapiens (Human)

Target Sequence

AHTAVISPQDPTLLIGSSLLATCSVHGDPPGATAEGLYWTLNGRRLPPELSRVLNASTLALALANLNGSRQRSGDNLVCHARDGSILAGSCLYVGLPPEKPVNISCWSKNMKDLTCRWTPGAHGETFLHTNYSLKYKLRWYGQDNTCEEYHTVGPHSCHIPKDLALFTPYEIWVEATNRLGSARSDVLTLDILDVVTTDPPPDVHVSRVGGLEDQLSVRWVSPPALKDFLFQAKYQIRYRVEDSVDWKVVDDVSNQTSCRLAGLKPGTVYFVQVRCNPFGIYGSKKAGIWSEWSHPTAASTPRSERPGPGGGACEPRGGEPSSGPVRRELKQFLGWLKKHAYCSNLSFRLYDQWRAWMQKSHKTRNQDEGILPSGRRGTARGPAR

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Immunology

Relevance

In complex with CLCF1, forms a heterodimeric neurotropic cytokine that plays a crucial role during neuronal development (Probable) . May also play a regulatory role in the immune system.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

50.0 kDa

References & Citations

"Cytokine-like factor-1, a novel soluble protein, shares homology with members of the cytokine type I receptor family." Elson G.C.A., Graber P., Losberger C., Herren S., Gretener D., Menoud L.N., Wells T.N.C., Kosco-Vilbois M.H., Gauchat J.-F. J. Immunol. 161:1371-1379 (1998)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF706 (NM_001042511) Human Tagged ORF Clone
RG220360 10 µg

ZNF706 (NM_001042511) Human Tagged ORF Clone

Sign In for Pricing
View Details
Optical Bench, Aluminum Extrusion
1110920 1 Each

Optical Bench, Aluminum Extrusion

Sign In for Pricing
View Details
Fam222a Mouse Gene Knockout Kit (CRISPR)
KN505658 1 Kit

Fam222a Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Hist1h2ail Protein Vector (Rat) (pPM-C-HA)
PV272840 500 ng

Hist1h2ail Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Fish free thyroxine (FT4) ELISA kit
MBS9424417-01 96 Tests

Fish free thyroxine (FT4) ELISA kit

Sign In for Pricing
View Details
Fish free thyroxine (FT4) ELISA kit
MBS9424417-02 5x 96 Tests

Fish free thyroxine (FT4) ELISA kit

Sign In for Pricing
View Details