Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-1 beta, Canine (Tag free)

IL-1 beta Protein, Canine (Tag free) is the recombinant canine-derived IL-1 beta, expressed by E. coli , with tag Free labeled tag.

Product Specifications

Product Name Alternative

IL-1 beta Protein, Canine (Tag free), Canine, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-1-beta-protein-canine-tag-free.html

Purity

98.00

Smiles

AAMQSVDCKLQDISHKYLVLSNSYELRALHLNGENVNKQVVFHMSFVHGDESNNKIPVVLGIKQKNLYLSCVMKDGKPTLQLEKVDPKVYPKRKMEKRFVFNKIEIKNTVEFESSQYPNWYISTSQVEGMPVFLGNTRGGQDITDFTMEFSS

Molecular Formula

403974 (Gene_ID) Q28292 (A115-S266) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

DNA Antibody
E55A11951 100 µg

DNA Antibody

Sign In for Pricing
View Details
Argonaute 3 Recombinant Protein Antigen
NBP2-13951PEP 0.1 mL

Argonaute 3 Recombinant Protein Antigen

Sign In for Pricing
View Details
RhoB Protein Lysate (Human) with C-Ha Tag
39511031 100 µg

RhoB Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
Mouse Immunoglobulin Kappa (Igk) CLIA Kit
abx496452-01 96 Tests

Mouse Immunoglobulin Kappa (Igk) CLIA Kit

Sign In for Pricing
View Details
Mouse Immunoglobulin Kappa (Igk) CLIA Kit
abx496452-02 5x 96 Tests

Mouse Immunoglobulin Kappa (Igk) CLIA Kit

Sign In for Pricing
View Details
Mouse Immunoglobulin Kappa (Igk) CLIA Kit
abx496452-03 10x 96 Tests

Mouse Immunoglobulin Kappa (Igk) CLIA Kit

Sign In for Pricing
View Details