Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-1 beta, Canine (Tag free)

IL-1 beta Protein, Canine (Tag free) is the recombinant canine-derived IL-1 beta, expressed by E. coli , with tag Free labeled tag.

Product Specifications

Product Name Alternative

IL-1 beta Protein, Canine (Tag free), Canine, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-1-beta-protein-canine-tag-free.html

Purity

98.00

Smiles

AAMQSVDCKLQDISHKYLVLSNSYELRALHLNGENVNKQVVFHMSFVHGDESNNKIPVVLGIKQKNLYLSCVMKDGKPTLQLEKVDPKVYPKRKMEKRFVFNKIEIKNTVEFESSQYPNWYISTSQVEGMPVFLGNTRGGQDITDFTMEFSS

Molecular Formula

403974 (Gene_ID) Q28292 (A115-S266) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Rasal3 shRNA (UAS) - Lentiviral mouse Rasal3 shRNA (UAS, RFP) plasmid
GTR15272917 1 Vial

Lentiviral mouse Rasal3 shRNA (UAS) - Lentiviral mouse Rasal3 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
OA3 Protein Vector (Human) (pPM-C-His)
PV105457 500 ng

OA3 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli O157:H7 PSPA Polyclonal Antibody
MBS7166399 Inquire

Rabbit anti-Escherichia coli O157:H7 PSPA Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Ighv5-8 activation kit by CRISPRa
GA218633 1 Kit

Mouse Ighv5-8 activation kit by CRISPRa

Sign In for Pricing
View Details
APC Anti-Human CD326/EpCAM (9C4)
MBS7620670-01 20 Tests

APC Anti-Human CD326/EpCAM (9C4)

Sign In for Pricing
View Details
APC Anti-Human CD326/EpCAM (9C4)
MBS7620670-02 100 Tests

APC Anti-Human CD326/EpCAM (9C4)

Sign In for Pricing
View Details