Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-1 beta, Canine (Tag free)

IL-1 beta Protein, Canine (Tag free) is the recombinant canine-derived IL-1 beta, expressed by E. coli , with tag Free labeled tag.

Product Specifications

Product Name Alternative

IL-1 beta Protein, Canine (Tag free), Canine, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-1-beta-protein-canine-tag-free.html

Purity

98.00

Smiles

AAMQSVDCKLQDISHKYLVLSNSYELRALHLNGENVNKQVVFHMSFVHGDESNNKIPVVLGIKQKNLYLSCVMKDGKPTLQLEKVDPKVYPKRKMEKRFVFNKIEIKNTVEFESSQYPNWYISTSQVEGMPVFLGNTRGGQDITDFTMEFSS

Molecular Formula

403974 (Gene_ID) Q28292 (A115-S266) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olr1492 ORF Vector (Rat) (pORF)
ORF072086 1.0 µg DNA

Olr1492 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
PMS2P5 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV772930 1.0 µg DNA

PMS2P5 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
RPL39P14 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV781240 1.0 µg DNA

RPL39P14 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
Human Aminopeptidase P1 (APP1) ELISA Kit
CK-bio-21775-01 48 Tests

Human Aminopeptidase P1 (APP1) ELISA Kit

Sign In for Pricing
View Details
Human Aminopeptidase P1 (APP1) ELISA Kit
CK-bio-21775-02 96 Tests

Human Aminopeptidase P1 (APP1) ELISA Kit

Sign In for Pricing
View Details
Tissue Total RNA, Lung
CR562203 5 µg

Tissue Total RNA, Lung

Sign In for Pricing
View Details