IL-1 beta, Canine (Tag free)
IL-1 beta Protein, Canine (Tag free) is the recombinant canine-derived IL-1 beta, expressed by E. coli , with tag Free labeled tag.
Product Specifications
Product Name Alternative
IL-1 beta Protein, Canine (Tag free), Canine, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/il-1-beta-protein-canine-tag-free.html
Purity
98.00
Smiles
AAMQSVDCKLQDISHKYLVLSNSYELRALHLNGENVNKQVVFHMSFVHGDESNNKIPVVLGIKQKNLYLSCVMKDGKPTLQLEKVDPKVYPKRKMEKRFVFNKIEIKNTVEFESSQYPNWYISTSQVEGMPVFLGNTRGGQDITDFTMEFSS
Molecular Formula
403974 (Gene_ID) Q28292 (A115-S266) (Accession)
Molecular Weight
Approximately 18 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
abx313942-01 20 µg
Cell Cycle Regulator Of Non-Homologous End Joining (CYREN) Antibody (HRP)
Sign In for Pricing
View Details 
abx313942-02 50 µg
Cell Cycle Regulator Of Non-Homologous End Joining (CYREN) Antibody (HRP)
Sign In for Pricing
View Details 
abx313942-03 100 µg
Cell Cycle Regulator Of Non-Homologous End Joining (CYREN) Antibody (HRP)
Sign In for Pricing
View Details abx313942-04 200 µg
Cell Cycle Regulator Of Non-Homologous End Joining (CYREN) Antibody (HRP)
Sign In for Pricing
View Details 
abx313942-05 1 mg
Cell Cycle Regulator Of Non-Homologous End Joining (CYREN) Antibody (HRP)
Sign In for Pricing
View Details