Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-1 beta, Canine (Tag free)

IL-1 beta Protein, Canine (Tag free) is the recombinant canine-derived IL-1 beta, expressed by E. coli , with tag Free labeled tag.

Product Specifications

Product Name Alternative

IL-1 beta Protein, Canine (Tag free), Canine, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-1-beta-protein-canine-tag-free.html

Purity

98.00

Smiles

AAMQSVDCKLQDISHKYLVLSNSYELRALHLNGENVNKQVVFHMSFVHGDESNNKIPVVLGIKQKNLYLSCVMKDGKPTLQLEKVDPKVYPKRKMEKRFVFNKIEIKNTVEFESSQYPNWYISTSQVEGMPVFLGNTRGGQDITDFTMEFSS

Molecular Formula

403974 (Gene_ID) Q28292 (A115-S266) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

FITC Anti-Mouse CD71 Antibody
JOT21071F 25μg

FITC Anti-Mouse CD71 Antibody

Sign In for Pricing
View Details
PRAME (NM_206955) Human Over-expression Lysate
LH16696V 100 µg

PRAME (NM_206955) Human Over-expression Lysate

Sign In for Pricing
View Details
Nek3, CT (Nek3, Serine/threonine-protein kinase Nek3, Never in mitosis A-related kinase 3) (AP)
MBS6324573-01 0.2 mL

Nek3, CT (Nek3, Serine/threonine-protein kinase Nek3, Never in mitosis A-related kinase 3) (AP)

Sign In for Pricing
View Details
Nek3, CT (Nek3, Serine/threonine-protein kinase Nek3, Never in mitosis A-related kinase 3) (AP)
MBS6324573-02 5x 0.2 mL

Nek3, CT (Nek3, Serine/threonine-protein kinase Nek3, Never in mitosis A-related kinase 3) (AP)

Sign In for Pricing
View Details
pLV3-U6-SLC16A4-shRNA1-Puro Plasmid
PVT52707 2 µg

pLV3-U6-SLC16A4-shRNA1-Puro Plasmid

Sign In for Pricing
View Details
Recombinant Human Peroxiredoxin-3
7-03460 5 µg

Recombinant Human Peroxiredoxin-3

Sign In for Pricing
View Details