Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-1 beta, Canine (Tag free)

IL-1 beta Protein, Canine (Tag free) is the recombinant canine-derived IL-1 beta, expressed by E. coli , with tag Free labeled tag.

Product Specifications

Product Name Alternative

IL-1 beta Protein, Canine (Tag free), Canine, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-1-beta-protein-canine-tag-free.html

Purity

98.00

Smiles

AAMQSVDCKLQDISHKYLVLSNSYELRALHLNGENVNKQVVFHMSFVHGDESNNKIPVVLGIKQKNLYLSCVMKDGKPTLQLEKVDPKVYPKRKMEKRFVFNKIEIKNTVEFESSQYPNWYISTSQVEGMPVFLGNTRGGQDITDFTMEFSS

Molecular Formula

403974 (Gene_ID) Q28292 (A115-S266) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

March11 (NM_001101828) Rat Tagged ORF Clone
RR206555 10 µg

March11 (NM_001101828) Rat Tagged ORF Clone

Sign In for Pricing
View Details
Neuropeptide B-29, Human (NPB-29)
302059 100 µg

Neuropeptide B-29, Human (NPB-29)

Sign In for Pricing
View Details
Yeast Nitrogen Base w/o AA & w/AS (YNB) Low Fe, Zn, Mn, Cu (Powder)
Y2037-01 100 g

Yeast Nitrogen Base w/o AA & w/AS (YNB) Low Fe, Zn, Mn, Cu (Powder)

Sign In for Pricing
View Details
Yeast Nitrogen Base w/o AA & w/AS (YNB) Low Fe, Zn, Mn, Cu (Powder)
Y2037-02 250 g

Yeast Nitrogen Base w/o AA & w/AS (YNB) Low Fe, Zn, Mn, Cu (Powder)

Sign In for Pricing
View Details
Yeast Nitrogen Base w/o AA & w/AS (YNB) Low Fe, Zn, Mn, Cu (Powder)
Y2037-03 500 g

Yeast Nitrogen Base w/o AA & w/AS (YNB) Low Fe, Zn, Mn, Cu (Powder)

Sign In for Pricing
View Details
Yeast Nitrogen Base w/o AA & w/AS (YNB) Low Fe, Zn, Mn, Cu (Powder)
Y2037-04 1 Kg

Yeast Nitrogen Base w/o AA & w/AS (YNB) Low Fe, Zn, Mn, Cu (Powder)

Sign In for Pricing
View Details