Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-1 beta, Canine (Tag free)

IL-1 beta Protein, Canine (Tag free) is the recombinant canine-derived IL-1 beta, expressed by E. coli , with tag Free labeled tag.

Product Specifications

Product Name Alternative

IL-1 beta Protein, Canine (Tag free), Canine, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-1-beta-protein-canine-tag-free.html

Purity

98.00

Smiles

AAMQSVDCKLQDISHKYLVLSNSYELRALHLNGENVNKQVVFHMSFVHGDESNNKIPVVLGIKQKNLYLSCVMKDGKPTLQLEKVDPKVYPKRKMEKRFVFNKIEIKNTVEFESSQYPNWYISTSQVEGMPVFLGNTRGGQDITDFTMEFSS

Molecular Formula

403974 (Gene_ID) Q28292 (A115-S266) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

HRG sgRNA CRISPR Lentivector (Human) (Target 2)
K0989403 1.0 µg DNA

HRG sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
ZNF468 (NM_001277120) Human Untagged Clone
SC333749 10 µg

ZNF468 (NM_001277120) Human Untagged Clone

Sign In for Pricing
View Details
CEP55 Antibody
OC-349-01 50 μL

CEP55 Antibody

Sign In for Pricing
View Details
CEP55 Antibody
OC-349-02 100 µL

CEP55 Antibody

Sign In for Pricing
View Details
CEP55 Antibody
OC-349-03 1 mL

CEP55 Antibody

Sign In for Pricing
View Details
FOXA1 (Forkhead Box A1, Hepatocyte Nuclear Factor 3 alpha, HNF3A, MGC33105, TCF3A) (FITC)
F9045-02A-FITC 100 µL

FOXA1 (Forkhead Box A1, Hepatocyte Nuclear Factor 3 alpha, HNF3A, MGC33105, TCF3A) (FITC)

Sign In for Pricing
View Details