Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-1 beta, Canine (Tag free)

IL-1 beta Protein, Canine (Tag free) is the recombinant canine-derived IL-1 beta, expressed by E. coli , with tag Free labeled tag.

Product Specifications

Product Name Alternative

IL-1 beta Protein, Canine (Tag free), Canine, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-1-beta-protein-canine-tag-free.html

Purity

98.00

Smiles

AAMQSVDCKLQDISHKYLVLSNSYELRALHLNGENVNKQVVFHMSFVHGDESNNKIPVVLGIKQKNLYLSCVMKDGKPTLQLEKVDPKVYPKRKMEKRFVFNKIEIKNTVEFESSQYPNWYISTSQVEGMPVFLGNTRGGQDITDFTMEFSS

Molecular Formula

403974 (Gene_ID) Q28292 (A115-S266) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRPF4 Recombinant Antibody, APC-Cy5.5 Conjugated
bsm-62963R-APC-Cy5.5 100 µL

PRPF4 Recombinant Antibody, APC-Cy5.5 Conjugated

Sign In for Pricing
View Details
Metallothionein 1F Double Nickase Plasmid (h)
sc-417937-NIC 20 µg

Metallothionein 1F Double Nickase Plasmid (h)

Sign In for Pricing
View Details
NOD1 sgRNA CRISPR Lentivector (Human) (Target 2)
K1438503 1.0 µg DNA

NOD1 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
BAF57 Rabbit Monoclonal Antibody
AMRe87075-01 1 Each

BAF57 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
BAF57 Rabbit Monoclonal Antibody
AMRe87075-02 50 µL

BAF57 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
BAF57 Rabbit Monoclonal Antibody
AMRe87075-03 100 µL

BAF57 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details