Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-1 beta, Canine (Tag free)

IL-1 beta Protein, Canine (Tag free) is the recombinant canine-derived IL-1 beta, expressed by E. coli , with tag Free labeled tag.

Product Specifications

Product Name Alternative

IL-1 beta Protein, Canine (Tag free), Canine, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-1-beta-protein-canine-tag-free.html

Purity

98.00

Smiles

AAMQSVDCKLQDISHKYLVLSNSYELRALHLNGENVNKQVVFHMSFVHGDESNNKIPVVLGIKQKNLYLSCVMKDGKPTLQLEKVDPKVYPKRKMEKRFVFNKIEIKNTVEFESSQYPNWYISTSQVEGMPVFLGNTRGGQDITDFTMEFSS

Molecular Formula

403974 (Gene_ID) Q28292 (A115-S266) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MEK7 (MAP2K7) pThr275 Rabbit Polyclonal Antibody
AP55765PU-S 50 µL

MEK7 (MAP2K7) pThr275 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
OR2J4P sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K1495806 1.0 µg DNA

OR2J4P sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
PODO Rabbit Polyclonal Antibody
E28PN2909 100 µL

PODO Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Hist1h4h sgRNA CRISPR Lentivector (Mouse) (Target 3)
K4053504 1.0 µg DNA

Hist1h4h sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Pseudomonas sp.
bs-72675R 100 µg

Pseudomonas sp.

Sign In for Pricing
View Details
Human Ephrin type-B receptor 3, EPHB3 ELISA Kit
MBS1606165-01 48 Well

Human Ephrin type-B receptor 3, EPHB3 ELISA Kit

Sign In for Pricing
View Details