Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-1 beta, Canine (Tag free)

IL-1 beta Protein, Canine (Tag free) is the recombinant canine-derived IL-1 beta, expressed by E. coli , with tag Free labeled tag.

Product Specifications

Product Name Alternative

IL-1 beta Protein, Canine (Tag free), Canine, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-1-beta-protein-canine-tag-free.html

Purity

98.00

Smiles

AAMQSVDCKLQDISHKYLVLSNSYELRALHLNGENVNKQVVFHMSFVHGDESNNKIPVVLGIKQKNLYLSCVMKDGKPTLQLEKVDPKVYPKRKMEKRFVFNKIEIKNTVEFESSQYPNWYISTSQVEGMPVFLGNTRGGQDITDFTMEFSS

Molecular Formula

403974 (Gene_ID) Q28292 (A115-S266) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPS6 Recombinant Protein (Human)
RP027208 100 µg

RPS6 Recombinant Protein (Human)

Sign In for Pricing
View Details
Mouse monoclonal antibody isotyping ELISA Kit
MBS9336712-01 48 Well

Mouse monoclonal antibody isotyping ELISA Kit

Sign In for Pricing
View Details
Mouse monoclonal antibody isotyping ELISA Kit
MBS9336712-02 96 Well

Mouse monoclonal antibody isotyping ELISA Kit

Sign In for Pricing
View Details
Mouse monoclonal antibody isotyping ELISA Kit
MBS9336712-03 5x 96 Well

Mouse monoclonal antibody isotyping ELISA Kit

Sign In for Pricing
View Details
Mouse monoclonal antibody isotyping ELISA Kit
MBS9336712-04 10x 96 Well

Mouse monoclonal antibody isotyping ELISA Kit

Sign In for Pricing
View Details
CD2BP2 sgRNA CRISPR Lentivector (Human) (Target 1)
K0399402 1.0 µg DNA

CD2BP2 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details