Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-1 beta, Canine (Tag free)

IL-1 beta Protein, Canine (Tag free) is the recombinant canine-derived IL-1 beta, expressed by E. coli , with tag Free labeled tag.

Product Specifications

Product Name Alternative

IL-1 beta Protein, Canine (Tag free), Canine, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-1-beta-protein-canine-tag-free.html

Purity

98.00

Smiles

AAMQSVDCKLQDISHKYLVLSNSYELRALHLNGENVNKQVVFHMSFVHGDESNNKIPVVLGIKQKNLYLSCVMKDGKPTLQLEKVDPKVYPKRKMEKRFVFNKIEIKNTVEFESSQYPNWYISTSQVEGMPVFLGNTRGGQDITDFTMEFSS

Molecular Formula

403974 (Gene_ID) Q28292 (A115-S266) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human α-tubulin
P0063 100 µg

Recombinant Human α-tubulin

Sign In for Pricing
View Details
ProCollagen Type I C-Terminal Propeptide (PICP) (HRP) discontinued
P9005-74E-HRP 200 µL

ProCollagen Type I C-Terminal Propeptide (PICP) (HRP) discontinued

Sign In for Pricing
View Details
Ercc5 3'UTR GFP Stable Cell Line
TU254072 1.0 mL

Ercc5 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
VN1R92P Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV755748 1.0 µg DNA

VN1R92P Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
SR-7 CRISPR Activation Plasmid (m)
sc-421001-ACT 20 µg

SR-7 CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details
Recombinant Yersinia pseudotuberculosis serotype IB Chaperone protein DnaJ (dnaJ)
MBS1237666-01 0.02 mg (E-Coli)

Recombinant Yersinia pseudotuberculosis serotype IB Chaperone protein DnaJ (dnaJ)

Sign In for Pricing
View Details