Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-1 beta, Canine (Tag free)

IL-1 beta Protein, Canine (Tag free) is the recombinant canine-derived IL-1 beta, expressed by E. coli , with tag Free labeled tag.

Product Specifications

Product Name Alternative

IL-1 beta Protein, Canine (Tag free), Canine, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-1-beta-protein-canine-tag-free.html

Purity

98.00

Smiles

AAMQSVDCKLQDISHKYLVLSNSYELRALHLNGENVNKQVVFHMSFVHGDESNNKIPVVLGIKQKNLYLSCVMKDGKPTLQLEKVDPKVYPKRKMEKRFVFNKIEIKNTVEFESSQYPNWYISTSQVEGMPVFLGNTRGGQDITDFTMEFSS

Molecular Formula

403974 (Gene_ID) Q28292 (A115-S266) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PGD synthetase / PGDS (1-199, His-tag) Human Protein
AR50381PU-S 100 µg

PGD synthetase / PGDS (1-199, His-tag) Human Protein

Sign In for Pricing
View Details
Cyp2c29 Mouse siRNA Oligo Duplex (Locus ID 13095)
SR415795 1 Kit

Cyp2c29 Mouse siRNA Oligo Duplex (Locus ID 13095)

Sign In for Pricing
View Details
Human ITGA2/Integrin alpha-2 ELISA Kit
MBS2891114-01 48 Well

Human ITGA2/Integrin alpha-2 ELISA Kit

Sign In for Pricing
View Details
Human ITGA2/Integrin alpha-2 ELISA Kit
MBS2891114-02 96 Well

Human ITGA2/Integrin alpha-2 ELISA Kit

Sign In for Pricing
View Details
Human ITGA2/Integrin alpha-2 ELISA Kit
MBS2891114-03 5x 96 Well

Human ITGA2/Integrin alpha-2 ELISA Kit

Sign In for Pricing
View Details
Human ITGA2/Integrin alpha-2 ELISA Kit
MBS2891114-04 10x 96 Well

Human ITGA2/Integrin alpha-2 ELISA Kit

Sign In for Pricing
View Details