Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-1 beta, Canine (Tag free)

IL-1 beta Protein, Canine (Tag free) is the recombinant canine-derived IL-1 beta, expressed by E. coli , with tag Free labeled tag.

Product Specifications

Product Name Alternative

IL-1 beta Protein, Canine (Tag free), Canine, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-1-beta-protein-canine-tag-free.html

Purity

98.00

Smiles

AAMQSVDCKLQDISHKYLVLSNSYELRALHLNGENVNKQVVFHMSFVHGDESNNKIPVVLGIKQKNLYLSCVMKDGKPTLQLEKVDPKVYPKRKMEKRFVFNKIEIKNTVEFESSQYPNWYISTSQVEGMPVFLGNTRGGQDITDFTMEFSS

Molecular Formula

403974 (Gene_ID) Q28292 (A115-S266) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Creb3l4 sgRNA CRISPR Lentivector (Rat) (Target 1)
K6263802 1.0 µg DNA

Creb3l4 sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Rbpms (NM_019733) Mouse Tagged ORF Clone Lentiviral Particle
MR201952L4V 200 µL

Rbpms (NM_019733) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
ZNF780A sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K2732707 1.0 µg DNA

ZNF780A sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Brain Natriuretic Peptide (BNP) Test Kit-human plasma
D-CIBNPK40 40 Tests

Brain Natriuretic Peptide (BNP) Test Kit-human plasma

Sign In for Pricing
View Details
[One Step] RPL36 Antibody Kit
RK05700 50 µL

[One Step] RPL36 Antibody Kit

Sign In for Pricing
View Details
DB07268
C12169-01 5 mg

DB07268

Sign In for Pricing
View Details