Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-1 beta, Canine (Tag free)

IL-1 beta Protein, Canine (Tag free) is the recombinant canine-derived IL-1 beta, expressed by E. coli , with tag Free labeled tag.

Product Specifications

Product Name Alternative

IL-1 beta Protein, Canine (Tag free), Canine, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-1-beta-protein-canine-tag-free.html

Purity

98.00

Smiles

AAMQSVDCKLQDISHKYLVLSNSYELRALHLNGENVNKQVVFHMSFVHGDESNNKIPVVLGIKQKNLYLSCVMKDGKPTLQLEKVDPKVYPKRKMEKRFVFNKIEIKNTVEFESSQYPNWYISTSQVEGMPVFLGNTRGGQDITDFTMEFSS

Molecular Formula

403974 (Gene_ID) Q28292 (A115-S266) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAI1 (SERPINE1) (NM_001165413) Human Untagged Clone
SC326946 10 µg

PAI1 (SERPINE1) (NM_001165413) Human Untagged Clone

Sign In for Pricing
View Details
Recombinant Rat Gap junction alpha-1 protein (Gja1)
MBS967257 Inquire

Recombinant Rat Gap junction alpha-1 protein (Gja1)

Sign In for Pricing
View Details
Amplirun® Escherichia Coli (EAEC) DNA Control
N15-MBC121 10000 - 20000 c/µL

Amplirun® Escherichia Coli (EAEC) DNA Control

Sign In for Pricing
View Details
Serotonin Hydrochloride 10mM * 1mL in DMSO
A16699-10mM-D 10 mM x 1mL in DMSO

Serotonin Hydrochloride 10mM * 1mL in DMSO

Sign In for Pricing
View Details
RAGE (AGER) (NM_001136) Human Tagged ORF Clone Lentiviral Particle
RC204664L4V 200 µL

RAGE (AGER) (NM_001136) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
TPSAB1 (Tryptase alpha/beta-1, Tryptase I, TPS1, TPS2, TPSB1) (HRP)
MBS6441515-01 0.1 mL

TPSAB1 (Tryptase alpha/beta-1, Tryptase I, TPS1, TPS2, TPSB1) (HRP)

Sign In for Pricing
View Details