Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-1 beta, Canine (Tag free)

IL-1 beta Protein, Canine (Tag free) is the recombinant canine-derived IL-1 beta, expressed by E. coli , with tag Free labeled tag.

Product Specifications

Product Name Alternative

IL-1 beta Protein, Canine (Tag free), Canine, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-1-beta-protein-canine-tag-free.html

Purity

98.00

Smiles

AAMQSVDCKLQDISHKYLVLSNSYELRALHLNGENVNKQVVFHMSFVHGDESNNKIPVVLGIKQKNLYLSCVMKDGKPTLQLEKVDPKVYPKRKMEKRFVFNKIEIKNTVEFESSQYPNWYISTSQVEGMPVFLGNTRGGQDITDFTMEFSS

Molecular Formula

403974 (Gene_ID) Q28292 (A115-S266) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CASP3 Protein Vector (Human) (pPB-C-His)
PV007553 500 ng

CASP3 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Mouse Elastase 3B (ELA3B) elisa kit
NSL1843m 96 Tests

Mouse Elastase 3B (ELA3B) elisa kit

Sign In for Pricing
View Details
SLC29A1 Antibody
MBS9416333-01 0.1 mL

SLC29A1 Antibody

Sign In for Pricing
View Details
SLC29A1 Antibody
MBS9416333-02 5x 0.1 mL

SLC29A1 Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal PIGP Antibody [Alexa Fluor 594]
NBP3-06346AF594 0.1 mL

Rabbit Polyclonal PIGP Antibody [Alexa Fluor 594]

Sign In for Pricing
View Details
CACNG5 sgRNA CRISPR Lentivector (Human) (Target 3)
K0352804 1.0 µg DNA

CACNG5 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details