Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-1 beta, Canine (Tag free)

IL-1 beta Protein, Canine (Tag free) is the recombinant canine-derived IL-1 beta, expressed by E. coli , with tag Free labeled tag.

Product Specifications

Product Name Alternative

IL-1 beta Protein, Canine (Tag free), Canine, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-1-beta-protein-canine-tag-free.html

Purity

98.00

Smiles

AAMQSVDCKLQDISHKYLVLSNSYELRALHLNGENVNKQVVFHMSFVHGDESNNKIPVVLGIKQKNLYLSCVMKDGKPTLQLEKVDPKVYPKRKMEKRFVFNKIEIKNTVEFESSQYPNWYISTSQVEGMPVFLGNTRGGQDITDFTMEFSS

Molecular Formula

403974 (Gene_ID) Q28292 (A115-S266) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat TnTf/TNNT3 (Troponin T Type 3, Fast Skeletal) ELISA Kit
RE2869R-01 48 Tests

Rat TnTf/TNNT3 (Troponin T Type 3, Fast Skeletal) ELISA Kit

Sign In for Pricing
View Details
Rat TnTf/TNNT3 (Troponin T Type 3, Fast Skeletal) ELISA Kit
RE2869R-02 96 Tests

Rat TnTf/TNNT3 (Troponin T Type 3, Fast Skeletal) ELISA Kit

Sign In for Pricing
View Details
PGPEP1 Recombinant Protein (Human)
RP083043 100 µg

PGPEP1 Recombinant Protein (Human)

Sign In for Pricing
View Details
Anti-Calpain 9  (3A6)
YF-MA11313 100 ug

Anti-Calpain 9 (3A6)

Sign In for Pricing
View Details
LYSM3 rabbit pAb
UB-GEN-8309 100 µL

LYSM3 rabbit pAb

Sign In for Pricing
View Details
KRTAP21-2 sgRNA CRISPR Lentivector (Human) (Target 1)
K1189602 1.0 µg DNA

KRTAP21-2 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details