Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-1 beta, Canine (Tag free)

IL-1 beta Protein, Canine (Tag free) is the recombinant canine-derived IL-1 beta, expressed by E. coli , with tag Free labeled tag.

Product Specifications

Product Name Alternative

IL-1 beta Protein, Canine (Tag free), Canine, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-1-beta-protein-canine-tag-free.html

Purity

98.00

Smiles

AAMQSVDCKLQDISHKYLVLSNSYELRALHLNGENVNKQVVFHMSFVHGDESNNKIPVVLGIKQKNLYLSCVMKDGKPTLQLEKVDPKVYPKRKMEKRFVFNKIEIKNTVEFESSQYPNWYISTSQVEGMPVFLGNTRGGQDITDFTMEFSS

Molecular Formula

403974 (Gene_ID) Q28292 (A115-S266) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

NUTM2G Human Gene Knockout Kit (CRISPR)
KN420221 1 Kit

NUTM2G Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Lentiviral human S100A7A shRNA (UAS) - Lentiviral human S100A7A shRNA (UAS, GFP) plasmid
GTR15128134 1 Vial

Lentiviral human S100A7A shRNA (UAS) - Lentiviral human S100A7A shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Scara5 (NM_028903) Mouse Tagged ORF Clone
MG207870 10 µg

Scara5 (NM_028903) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Bovine Lactoferrin antibody IgG (LF/LTF Ab-IgG) ELISA Kit
OM624409 96 Strip Well

Bovine Lactoferrin antibody IgG (LF/LTF Ab-IgG) ELISA Kit

Sign In for Pricing
View Details
(2S,6S) -Hydroxynorketamine
MF-0002731-01 10 mg

(2S,6S) -Hydroxynorketamine

Sign In for Pricing
View Details
(2S,6S) -Hydroxynorketamine
MF-0002731-02 50 mg

(2S,6S) -Hydroxynorketamine

Sign In for Pricing
View Details