Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-1 beta, Canine (Tag free)

IL-1 beta Protein, Canine (Tag free) is the recombinant canine-derived IL-1 beta, expressed by E. coli , with tag Free labeled tag.

Product Specifications

Product Name Alternative

IL-1 beta Protein, Canine (Tag free), Canine, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-1-beta-protein-canine-tag-free.html

Purity

98.00

Smiles

AAMQSVDCKLQDISHKYLVLSNSYELRALHLNGENVNKQVVFHMSFVHGDESNNKIPVVLGIKQKNLYLSCVMKDGKPTLQLEKVDPKVYPKRKMEKRFVFNKIEIKNTVEFESSQYPNWYISTSQVEGMPVFLGNTRGGQDITDFTMEFSS

Molecular Formula

403974 (Gene_ID) Q28292 (A115-S266) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

hsa-miR-5681a miRNA Antagomir
MNH03114 2x 5.0 nmol

hsa-miR-5681a miRNA Antagomir

Sign In for Pricing
View Details
IDO1 Polyclonal Antibody
NHP-AB383 Each

IDO1 Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Epn3 Pre-designed siRNA Set B
SI104371B 1 Each

Mouse Epn3 Pre-designed siRNA Set B

Sign In for Pricing
View Details
AASD-PPT Antibody
C16447-01 50 μL

AASD-PPT Antibody

Sign In for Pricing
View Details
AASD-PPT Antibody
C16447-02 100 µL

AASD-PPT Antibody

Sign In for Pricing
View Details
IL3R, Phosphorylated (Tyr766) (Cytokine Receptor Common beta, GM-CSF/IL-3/IL-5 Receptor Common beta Subunit, CD131, CDw131 antigen, CSF2RB, IL3RB, IL5RB) (PE)
MBS6482590-01 0.2 mL

IL3R, Phosphorylated (Tyr766) (Cytokine Receptor Common beta, GM-CSF/IL-3/IL-5 Receptor Common beta Subunit, CD131, CDw131 antigen, CSF2RB, IL3RB, IL5RB) (PE)

Sign In for Pricing
View Details