Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-1 beta, Canine (Tag free)

IL-1 beta Protein, Canine (Tag free) is the recombinant canine-derived IL-1 beta, expressed by E. coli , with tag Free labeled tag.

Product Specifications

Product Name Alternative

IL-1 beta Protein, Canine (Tag free), Canine, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-1-beta-protein-canine-tag-free.html

Purity

98.00

Smiles

AAMQSVDCKLQDISHKYLVLSNSYELRALHLNGENVNKQVVFHMSFVHGDESNNKIPVVLGIKQKNLYLSCVMKDGKPTLQLEKVDPKVYPKRKMEKRFVFNKIEIKNTVEFESSQYPNWYISTSQVEGMPVFLGNTRGGQDITDFTMEFSS

Molecular Formula

403974 (Gene_ID) Q28292 (A115-S266) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

HAL (Histidine Ammonia-lyase, Histidase, HIS) (Biotin)
MBS6142221-01 0.1 mL

HAL (Histidine Ammonia-lyase, Histidase, HIS) (Biotin)

Sign In for Pricing
View Details
HAL (Histidine Ammonia-lyase, Histidase, HIS) (Biotin)
MBS6142221-02 5x 0.1 mL

HAL (Histidine Ammonia-lyase, Histidase, HIS) (Biotin)

Sign In for Pricing
View Details
Frozen Tissue Sections, Breast
CS519853 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details
Dclk1 3'UTR Luciferase Stable Cell Line
TU203195 1.0 mL

Dclk1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Flowgen Digital Dry Bath Dual Position
BLO2252 1 Each

Flowgen Digital Dry Bath Dual Position

Sign In for Pricing
View Details
Respiratory Adenovirus Antigen Rapid Test (Nasal)
HSGIA2200A1AdV 25 Tests/Kit

Respiratory Adenovirus Antigen Rapid Test (Nasal)

Sign In for Pricing
View Details