Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-1 beta, Canine (Tag free)

IL-1 beta Protein, Canine (Tag free) is the recombinant canine-derived IL-1 beta, expressed by E. coli , with tag Free labeled tag.

Product Specifications

Product Name Alternative

IL-1 beta Protein, Canine (Tag free), Canine, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-1-beta-protein-canine-tag-free.html

Purity

98.00

Smiles

AAMQSVDCKLQDISHKYLVLSNSYELRALHLNGENVNKQVVFHMSFVHGDESNNKIPVVLGIKQKNLYLSCVMKDGKPTLQLEKVDPKVYPKRKMEKRFVFNKIEIKNTVEFESSQYPNWYISTSQVEGMPVFLGNTRGGQDITDFTMEFSS

Molecular Formula

403974 (Gene_ID) Q28292 (A115-S266) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human MTLRP (GHRL) (NM_001302825) AAV Particle
RC235752A1V 250 µL

Human MTLRP (GHRL) (NM_001302825) AAV Particle

Sign In for Pricing
View Details
ZNF365 Antibody
MBS9415695-01 0.1 mL

ZNF365 Antibody

Sign In for Pricing
View Details
ZNF365 Antibody
MBS9415695-02 5x 0.1 mL

ZNF365 Antibody

Sign In for Pricing
View Details
Lentiviral mouse Haus1 shRNA (UAS) - Lentiviral mouse Haus1 shRNA (UAS, GFP) (100)
GTR15143661 1 Vial

Lentiviral mouse Haus1 shRNA (UAS) - Lentiviral mouse Haus1 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
C18orf65 Human shRNA Plasmid Kit (Locus ID 400658)
TL308006 1 Kit

C18orf65 Human shRNA Plasmid Kit (Locus ID 400658)

Sign In for Pricing
View Details
C4orf26 HDR Plasmid (h)
sc-417706-HDR 20 µg

C4orf26 HDR Plasmid (h)

Sign In for Pricing
View Details