Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-1 beta, Canine (Tag free)

IL-1 beta Protein, Canine (Tag free) is the recombinant canine-derived IL-1 beta, expressed by E. coli , with tag Free labeled tag.

Product Specifications

Product Name Alternative

IL-1 beta Protein, Canine (Tag free), Canine, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-1-beta-protein-canine-tag-free.html

Purity

98.00

Smiles

AAMQSVDCKLQDISHKYLVLSNSYELRALHLNGENVNKQVVFHMSFVHGDESNNKIPVVLGIKQKNLYLSCVMKDGKPTLQLEKVDPKVYPKRKMEKRFVFNKIEIKNTVEFESSQYPNWYISTSQVEGMPVFLGNTRGGQDITDFTMEFSS

Molecular Formula

403974 (Gene_ID) Q28292 (A115-S266) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TGFB1 (Transforming Growth Factor beta-1, TGF-beta-1, TGFB) (PE)
MBS6396389-01 0.1 mL

TGFB1 (Transforming Growth Factor beta-1, TGF-beta-1, TGFB) (PE)

Sign In for Pricing
View Details
TGFB1 (Transforming Growth Factor beta-1, TGF-beta-1, TGFB) (PE)
MBS6396389-02 5x 0.1 mL

TGFB1 (Transforming Growth Factor beta-1, TGF-beta-1, TGFB) (PE)

Sign In for Pricing
View Details
Mouse Rbm15b Pre-designed siRNA Set A
SI111758A 1 Each

Mouse Rbm15b Pre-designed siRNA Set A

Sign In for Pricing
View Details
EG-VEGF, human recombinant
4571-50 50 µg

EG-VEGF, human recombinant

Sign In for Pricing
View Details
SLC25A5P2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV785934 1.0 µg DNA

SLC25A5P2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
Rat Lgi1 Pre-designed siRNA Set B
SI207583B 1 Each

Rat Lgi1 Pre-designed siRNA Set B

Sign In for Pricing
View Details