Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-1 beta, Canine (Tag free)

IL-1 beta Protein, Canine (Tag free) is the recombinant canine-derived IL-1 beta, expressed by E. coli , with tag Free labeled tag.

Product Specifications

Product Name Alternative

IL-1 beta Protein, Canine (Tag free), Canine, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-1-beta-protein-canine-tag-free.html

Purity

98.00

Smiles

AAMQSVDCKLQDISHKYLVLSNSYELRALHLNGENVNKQVVFHMSFVHGDESNNKIPVVLGIKQKNLYLSCVMKDGKPTLQLEKVDPKVYPKRKMEKRFVFNKIEIKNTVEFESSQYPNWYISTSQVEGMPVFLGNTRGGQDITDFTMEFSS

Molecular Formula

403974 (Gene_ID) Q28292 (A115-S266) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

C5orf25 (SIMC1) Human shRNA Plasmid Kit (Locus ID 375484)
TL305832 1 Kit

C5orf25 (SIMC1) Human shRNA Plasmid Kit (Locus ID 375484)

Sign In for Pricing
View Details
HA-P62 (230-440aa)
BZ18305 1 Vial

HA-P62 (230-440aa)

Sign In for Pricing
View Details
RAB11FIP4 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
38296124 3x 1.0µg DNA

RAB11FIP4 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
Easy-Eluted Protein G - 10 mg
NRPA30S-10 10mg

Easy-Eluted Protein G - 10 mg

Sign In for Pricing
View Details
3,5-Bis (4-aminophenoxy) benzoic Acid
sc-486021 1 g

3,5-Bis (4-aminophenoxy) benzoic Acid

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Granzyme H (GZMH)
MBS2082991-01 0.1 mL

PE-Linked Polyclonal Antibody to Granzyme H (GZMH)

Sign In for Pricing
View Details