Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-1 beta, Canine (Tag free)

IL-1 beta Protein, Canine (Tag free) is the recombinant canine-derived IL-1 beta, expressed by E. coli , with tag Free labeled tag.

Product Specifications

Product Name Alternative

IL-1 beta Protein, Canine (Tag free), Canine, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-1-beta-protein-canine-tag-free.html

Purity

98.00

Smiles

AAMQSVDCKLQDISHKYLVLSNSYELRALHLNGENVNKQVVFHMSFVHGDESNNKIPVVLGIKQKNLYLSCVMKDGKPTLQLEKVDPKVYPKRKMEKRFVFNKIEIKNTVEFESSQYPNWYISTSQVEGMPVFLGNTRGGQDITDFTMEFSS

Molecular Formula

403974 (Gene_ID) Q28292 (A115-S266) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TSSK3 (Testis-specific Serine/threonine-protein Kinase 3, TSSK-3, Testis-specific Kinase 3, TSK3, TSK-3, Serine/threonine-protein Kinase 22C, STK22C, SPOGA3) (AP)
MBS6134361-01 0.1 mL

TSSK3 (Testis-specific Serine/threonine-protein Kinase 3, TSSK-3, Testis-specific Kinase 3, TSK3, TSK-3, Serine/threonine-protein Kinase 22C, STK22C, SPOGA3) (AP)

Sign In for Pricing
View Details
TSSK3 (Testis-specific Serine/threonine-protein Kinase 3, TSSK-3, Testis-specific Kinase 3, TSK3, TSK-3, Serine/threonine-protein Kinase 22C, STK22C, SPOGA3) (AP)
MBS6134361-02 5x 0.1 mL

TSSK3 (Testis-specific Serine/threonine-protein Kinase 3, TSSK-3, Testis-specific Kinase 3, TSK3, TSK-3, Serine/threonine-protein Kinase 22C, STK22C, SPOGA3) (AP)

Sign In for Pricing
View Details
RPL21P124 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV778119 1.0 µg DNA

RPL21P124 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
BRD4 3'UTR GFP Stable Cell Line
TU051886 1x106 cells / 1.0 mL

BRD4 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
KCNK10 (NM_138318) Human Tagged ORF Clone
RG210446 10 µg

KCNK10 (NM_138318) Human Tagged ORF Clone

Sign In for Pricing
View Details
Schistosoma mansoni, t.s. of adult male and female
Py224e 7.6 x 2.6 cm

Schistosoma mansoni, t.s. of adult male and female

Sign In for Pricing
View Details