Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-1 beta, Canine (Tag free)

IL-1 beta Protein, Canine (Tag free) is the recombinant canine-derived IL-1 beta, expressed by E. coli , with tag Free labeled tag.

Product Specifications

Product Name Alternative

IL-1 beta Protein, Canine (Tag free), Canine, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-1-beta-protein-canine-tag-free.html

Purity

98.00

Smiles

AAMQSVDCKLQDISHKYLVLSNSYELRALHLNGENVNKQVVFHMSFVHGDESNNKIPVVLGIKQKNLYLSCVMKDGKPTLQLEKVDPKVYPKRKMEKRFVFNKIEIKNTVEFESSQYPNWYISTSQVEGMPVFLGNTRGGQDITDFTMEFSS

Molecular Formula

403974 (Gene_ID) Q28292 (A115-S266) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

AGTRAP sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K0060107 1.0 µg DNA

AGTRAP sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
P15RS (C-6) HRP
sc-514724 HRP 200 µg/mL

P15RS (C-6) HRP

Sign In for Pricing
View Details
RNF168 (NM_152617) Human Tagged ORF Clone
RG207642 10 µg

RNF168 (NM_152617) Human Tagged ORF Clone

Sign In for Pricing
View Details
FMO10P sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K0790408 1.0 µg DNA

FMO10P sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Recombinant Human Intestinal-type alkaline phosphatase (ALPI) ,partial
RPC20199-01 20 µg

Recombinant Human Intestinal-type alkaline phosphatase (ALPI) ,partial

Sign In for Pricing
View Details
Recombinant Human Intestinal-type alkaline phosphatase (ALPI) ,partial
RPC20199-02 100 µg

Recombinant Human Intestinal-type alkaline phosphatase (ALPI) ,partial

Sign In for Pricing
View Details