Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-1 beta, Canine (Tag free)

IL-1 beta Protein, Canine (Tag free) is the recombinant canine-derived IL-1 beta, expressed by E. coli , with tag Free labeled tag.

Product Specifications

Product Name Alternative

IL-1 beta Protein, Canine (Tag free), Canine, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-1-beta-protein-canine-tag-free.html

Purity

98.00

Smiles

AAMQSVDCKLQDISHKYLVLSNSYELRALHLNGENVNKQVVFHMSFVHGDESNNKIPVVLGIKQKNLYLSCVMKDGKPTLQLEKVDPKVYPKRKMEKRFVFNKIEIKNTVEFESSQYPNWYISTSQVEGMPVFLGNTRGGQDITDFTMEFSS

Molecular Formula

403974 (Gene_ID) Q28292 (A115-S266) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PKC delta (PRKCD) (NM_212539) Human Recombinant Protein
TP308127L 1 mg

PKC delta (PRKCD) (NM_212539) Human Recombinant Protein

Sign In for Pricing
View Details
CDK11A (NM_024011) Human Tagged ORF Clone
RG214848 10 µg

CDK11A (NM_024011) Human Tagged ORF Clone

Sign In for Pricing
View Details
CDAN3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K0408708 1.0 µg DNA

CDAN3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Lentiviral human LCP2 shRNA (UAS) - Lentiviral human LCP2 shRNA (UAS, RFP) (100)
GTR15083244 1 Vial

Lentiviral human LCP2 shRNA (UAS) - Lentiviral human LCP2 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
Goose Protein ENL (MLLT1) ELISA Kit
MBS9930341 Inquire

Goose Protein ENL (MLLT1) ELISA Kit

Sign In for Pricing
View Details
OR10K1 CRISPR/Cas9 KO Plasmid (h)
sc-415913 20 µg

OR10K1 CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details