IL-1 beta, Canine (Tag free)

IL-1 beta Protein, Canine (Tag free) is the recombinant canine-derived IL-1 beta, expressed by E. coli , with tag Free labeled tag.

Product Specifications

Product Name Alternative

IL-1 beta Protein, Canine (Tag free), Canine, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-1-beta-protein-canine-tag-free.html

Purity

98.00

Smiles

AAMQSVDCKLQDISHKYLVLSNSYELRALHLNGENVNKQVVFHMSFVHGDESNNKIPVVLGIKQKNLYLSCVMKDGKPTLQLEKVDPKVYPKRKMEKRFVFNKIEIKNTVEFESSQYPNWYISTSQVEGMPVFLGNTRGGQDITDFTMEFSS

Molecular Formula

403974 (Gene_ID) Q28292 (A115-S266) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

KMPH3508-01 20 µg

Human MARK3 Protein, His & GST Tag

View Details

KMPH3508-02 50 µg

Human MARK3 Protein, His & GST Tag

View Details

127217-ML490 100 µL

GC1qR (Complement Component 1 Q Subcomponent-binding Protein Mitochondrial, Glycoprotein gC1qBP, C1qBP, GC1q-R Protein, GC1QBP, Hyaluronan-binding Protein 1, HABP1, Mitochondrial Matrix Protein p32, p33, SF2P32) (MaxLight 490)

View Details

SC333326 10 µg

GLIPR2 (NM_001287012) Human Untagged Clone

View Details

F782756 24 / PCK

6-well Insert 2in1 PET-membrane 8.0 um

View Details

NBP3-27036F 0.1 mL

Mouse Monoclonal ARID1A Antibody (ARID1A/7735) [FITC]

View Details