Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-1 beta, Canine (Tag free)

IL-1 beta Protein, Canine (Tag free) is the recombinant canine-derived IL-1 beta, expressed by E. coli , with tag Free labeled tag.

Product Specifications

Product Name Alternative

IL-1 beta Protein, Canine (Tag free), Canine, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-1-beta-protein-canine-tag-free.html

Purity

98.00

Smiles

AAMQSVDCKLQDISHKYLVLSNSYELRALHLNGENVNKQVVFHMSFVHGDESNNKIPVVLGIKQKNLYLSCVMKDGKPTLQLEKVDPKVYPKRKMEKRFVFNKIEIKNTVEFESSQYPNWYISTSQVEGMPVFLGNTRGGQDITDFTMEFSS

Molecular Formula

403974 (Gene_ID) Q28292 (A115-S266) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

EEF1E1 Protein Vector (Mouse) (pPM-C-His)
PV174553 500 ng

EEF1E1 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
0.2 mL Standard Profile qPCR 96 Well Plate (Se...
MB-Q96-S 0.2 mL

0.2 mL Standard Profile qPCR 96 Well Plate (Se...

Sign In for Pricing
View Details
Mouse Monoclonal GOLM1 Antibody (OTI4B12) - Azide and BSA Free
NBP2-71916 100 µg

Mouse Monoclonal GOLM1 Antibody (OTI4B12) - Azide and BSA Free

Sign In for Pricing
View Details
Recombinant Human ZFP36
P2225-01 50 µg

Recombinant Human ZFP36

Sign In for Pricing
View Details
Recombinant Human ZFP36
P2225-02 200 µg

Recombinant Human ZFP36

Sign In for Pricing
View Details
Recombinant Human ZFP36
P2225-03 1 mg

Recombinant Human ZFP36

Sign In for Pricing
View Details