Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-1 beta, Canine (Tag free)

IL-1 beta Protein, Canine (Tag free) is the recombinant canine-derived IL-1 beta, expressed by E. coli , with tag Free labeled tag.

Product Specifications

Product Name Alternative

IL-1 beta Protein, Canine (Tag free), Canine, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-1-beta-protein-canine-tag-free.html

Purity

98.00

Smiles

AAMQSVDCKLQDISHKYLVLSNSYELRALHLNGENVNKQVVFHMSFVHGDESNNKIPVVLGIKQKNLYLSCVMKDGKPTLQLEKVDPKVYPKRKMEKRFVFNKIEIKNTVEFESSQYPNWYISTSQVEGMPVFLGNTRGGQDITDFTMEFSS

Molecular Formula

403974 (Gene_ID) Q28292 (A115-S266) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monoclonal CaMKI Antibody, Clone: EPR2217Y
AMM05683G 0.1ml

Monoclonal CaMKI Antibody, Clone: EPR2217Y

Sign In for Pricing
View Details
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) INVB Polyclonal Antibody
MBS7146862 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) INVB Polyclonal Antibody

Sign In for Pricing
View Details
CD28 (CD28 Antigen, CD28 Molecule, MGC138290, T cell Antigen CD28, T cell Specific Surface Glycoprotein, T cell Specific Surface Glycoprotein CD28, Tp44) (Azide Free)
C2380-18AX 500 µg

CD28 (CD28 Antigen, CD28 Molecule, MGC138290, T cell Antigen CD28, T cell Specific Surface Glycoprotein, T cell Specific Surface Glycoprotein CD28, Tp44) (Azide Free)

Sign In for Pricing
View Details
Cfhl1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV670231 1.0 µg DNA

Cfhl1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
STAMBPL1 Over-expression Lysate Product
GWB-F6B73E 0.1 mg

STAMBPL1 Over-expression Lysate Product

Sign In for Pricing
View Details
PFDN5 Protein, Human, Recombinant (His Tag)
PH51197E1 100 µg

PFDN5 Protein, Human, Recombinant (His Tag)

Sign In for Pricing
View Details