Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-1 beta, Canine (Tag free)

IL-1 beta Protein, Canine (Tag free) is the recombinant canine-derived IL-1 beta, expressed by E. coli , with tag Free labeled tag.

Product Specifications

Product Name Alternative

IL-1 beta Protein, Canine (Tag free), Canine, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-1-beta-protein-canine-tag-free.html

Purity

98.00

Smiles

AAMQSVDCKLQDISHKYLVLSNSYELRALHLNGENVNKQVVFHMSFVHGDESNNKIPVVLGIKQKNLYLSCVMKDGKPTLQLEKVDPKVYPKRKMEKRFVFNKIEIKNTVEFESSQYPNWYISTSQVEGMPVFLGNTRGGQDITDFTMEFSS

Molecular Formula

403974 (Gene_ID) Q28292 (A115-S266) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

B4gat1 (NM_175383) Mouse Tagged ORF Clone Lentiviral Particle
MR206563L3V 200 µL

B4gat1 (NM_175383) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Lentiviral mouse Snrpd1 shRNA (UAS) - Lentiviral mouse Snrpd1 shRNA (UAS, iRFP) (25)
GTR15142046 1 Vial

Lentiviral mouse Snrpd1 shRNA (UAS) - Lentiviral mouse Snrpd1 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
BAY 80-6946 Amide
TRC-B119050-100MG 100 mg

BAY 80-6946 Amide

Sign In for Pricing
View Details
SOWAHB Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV786247 1.0 µg DNA

SOWAHB Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
Recombinant Francisella tularensis subsp. tularensis Translation initiation factor IF-1 (infA)
MBS1482587-01 0.02 mg (E-Coli)

Recombinant Francisella tularensis subsp. tularensis Translation initiation factor IF-1 (infA)

Sign In for Pricing
View Details
Recombinant Francisella tularensis subsp. tularensis Translation initiation factor IF-1 (infA)
MBS1482587-02 0.1 mg (E-Coli)

Recombinant Francisella tularensis subsp. tularensis Translation initiation factor IF-1 (infA)

Sign In for Pricing
View Details