Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-1 beta, Canine (Tag free)

IL-1 beta Protein, Canine (Tag free) is the recombinant canine-derived IL-1 beta, expressed by E. coli , with tag Free labeled tag.

Product Specifications

Product Name Alternative

IL-1 beta Protein, Canine (Tag free), Canine, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-1-beta-protein-canine-tag-free.html

Purity

98.00

Smiles

AAMQSVDCKLQDISHKYLVLSNSYELRALHLNGENVNKQVVFHMSFVHGDESNNKIPVVLGIKQKNLYLSCVMKDGKPTLQLEKVDPKVYPKRKMEKRFVFNKIEIKNTVEFESSQYPNWYISTSQVEGMPVFLGNTRGGQDITDFTMEFSS

Molecular Formula

403974 (Gene_ID) Q28292 (A115-S266) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vari Fluor 488 TSA (200x)
HY-D1837-01 10 µL

Vari Fluor 488 TSA (200x)

Sign In for Pricing
View Details
Vari Fluor 488 TSA (200x)
HY-D1837-02 100 µL

Vari Fluor 488 TSA (200x)

Sign In for Pricing
View Details
NFE2L2 (Nuclear Factor (erythroid-Derived 2) -like 2, NRF2) (MaxLight 550)
249284-ML550 100 µL

NFE2L2 (Nuclear Factor (erythroid-Derived 2) -like 2, NRF2) (MaxLight 550)

Sign In for Pricing
View Details
Ankrd52 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K6207706 1.0 µg DNA

Ankrd52 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Angiomotin (AMOT)
351761 100 µL

Angiomotin (AMOT)

Sign In for Pricing
View Details
Spata33 (NM_177279) Mouse Tagged Lenti ORF Clone
MR212801L4 10 µg

Spata33 (NM_177279) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details