Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-1 beta, Canine (Tag free)

IL-1 beta Protein, Canine (Tag free) is the recombinant canine-derived IL-1 beta, expressed by E. coli , with tag Free labeled tag.

Product Specifications

Product Name Alternative

IL-1 beta Protein, Canine (Tag free), Canine, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-1-beta-protein-canine-tag-free.html

Purity

98.00

Smiles

AAMQSVDCKLQDISHKYLVLSNSYELRALHLNGENVNKQVVFHMSFVHGDESNNKIPVVLGIKQKNLYLSCVMKDGKPTLQLEKVDPKVYPKRKMEKRFVFNKIEIKNTVEFESSQYPNWYISTSQVEGMPVFLGNTRGGQDITDFTMEFSS

Molecular Formula

403974 (Gene_ID) Q28292 (A115-S266) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

NDE1, NT (Nuclear Distribution Protein nudE Homolog 1, NUDE1, NUDE, FLJ20101, HOM-TES-87) (MaxLight 405)
MBS6489533-01 0.1 mL

NDE1, NT (Nuclear Distribution Protein nudE Homolog 1, NUDE1, NUDE, FLJ20101, HOM-TES-87) (MaxLight 405)

Sign In for Pricing
View Details
NDE1, NT (Nuclear Distribution Protein nudE Homolog 1, NUDE1, NUDE, FLJ20101, HOM-TES-87) (MaxLight 405)
MBS6489533-02 5x 0.1 mL

NDE1, NT (Nuclear Distribution Protein nudE Homolog 1, NUDE1, NUDE, FLJ20101, HOM-TES-87) (MaxLight 405)

Sign In for Pricing
View Details
TMEM93 Polyclonal Antibody
MBS9235895-01 0.1 mL

TMEM93 Polyclonal Antibody

Sign In for Pricing
View Details
TMEM93 Polyclonal Antibody
MBS9235895-02 5x 0.1 mL

TMEM93 Polyclonal Antibody

Sign In for Pricing
View Details
Sec14l3-set siRNA/shRNA/RNAi Lentivector (Mouse)
43288094 4x 500 ng

Sec14l3-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details
Mouse Monoclonal Influenza B Virus Antibody (1131 (2B2)) [Alexa Fluor 532]
NB100-65034AF532 0.1 mL

Mouse Monoclonal Influenza B Virus Antibody (1131 (2B2)) [Alexa Fluor 532]

Sign In for Pricing
View Details