CCL24/Eotaxin-2, Mouse (HEK293, Fc)

CCL24/Eotaxin-2 Protein, Mouse (HEK293, Fc) is a CC chemokine that interacts with the chemokine receptor CCR3 to induce eosinophil chemotaxis and mediate atopic diseases, parasitic infections and systemic diseases, as well as promote cellular transport and regulate inflammatory and fibrotic activities. CCL24/Eotaxin-2 Protein, Mouse (HEK293, Fc) is a recombinant mouse CCL24/Eotaxin-2 (V27-V119) protein expressed by HEK293 with a hFc tag at the N-terminus[1].

Product Specifications

Product Name Alternative

CCL24/Eotaxin-2 Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ccl24-eotaxin-2-protein-mouse-hek293-fc.html

Purity

95.0

Smiles

VTIPSSCCTSFISKKIPENRVVSYQLANGSICPKAGVIFITKKGHKICTDPKLLWVQRHIQKLDAKKNQPSKGAKAVRTKFAVQRRRGNSTEV

Molecular Formula

56221 (Gene_ID) Q9JKC0 (V27-V119) (Accession)

Molecular Weight

Approximately 40-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Hui Li, et al. Trophoblasts-derived chemokine CCL24 promotes the proliferation, growth and apoptosis of decidual stromal cells in human early pregnancy. Int J Clin Exp Pathol. 2013 May 15;6 (6) :1028-37.|[2]Michal Segal-Salto, et al. A blocking monoclonal antibody to CCL24 alleviates liver fibrosis and inflammation in experimental models of liver damage. JHEP Rep. 2020 Jan 2;2 (1) :100064.|[3]Adi Mor, et al. Blockade of CCL24 with a monoclonal antibody ameliorates experimental dermal and pulmonary fibrosis. Ann Rheum Dis. 2019 Sep;78 (9) :1260-1268.