Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCL24/Eotaxin-2, Mouse (HEK293, Fc)

CCL24/Eotaxin-2 Protein, Mouse (HEK293, Fc) is a CC chemokine that interacts with the chemokine receptor CCR3 to induce eosinophil chemotaxis and mediate atopic diseases, parasitic infections and systemic diseases, as well as promote cellular transport and regulate inflammatory and fibrotic activities. CCL24/Eotaxin-2 Protein, Mouse (HEK293, Fc) is a recombinant mouse CCL24/Eotaxin-2 (V27-V119) protein expressed by HEK293 with a hFc tag at the N-terminus[1].

Product Specifications

Product Name Alternative

CCL24/Eotaxin-2 Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ccl24-eotaxin-2-protein-mouse-hek293-fc.html

Purity

95.0

Smiles

VTIPSSCCTSFISKKIPENRVVSYQLANGSICPKAGVIFITKKGHKICTDPKLLWVQRHIQKLDAKKNQPSKGAKAVRTKFAVQRRRGNSTEV

Molecular Formula

56221 (Gene_ID) Q9JKC0 (V27-V119) (Accession)

Molecular Weight

Approximately 40-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Hui Li, et al. Trophoblasts-derived chemokine CCL24 promotes the proliferation, growth and apoptosis of decidual stromal cells in human early pregnancy. Int J Clin Exp Pathol. 2013 May 15;6 (6) :1028-37.|[2]Michal Segal-Salto, et al. A blocking monoclonal antibody to CCL24 alleviates liver fibrosis and inflammation in experimental models of liver damage. JHEP Rep. 2020 Jan 2;2 (1) :100064.|[3]Adi Mor, et al. Blockade of CCL24 with a monoclonal antibody ameliorates experimental dermal and pulmonary fibrosis. Ann Rheum Dis. 2019 Sep;78 (9) :1260-1268.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-CD20 [2H7]
MBS489000-01 0.2 mg

Anti-CD20 [2H7]

Sign In for Pricing
View Details
Anti-CD20 [2H7]
MBS489000-02 5x 0.2 mg

Anti-CD20 [2H7]

Sign In for Pricing
View Details
PEnCMV-SCD (human) -3xFLAG
BZ30359 1 Vial

PEnCMV-SCD (human) -3xFLAG

Sign In for Pricing
View Details
Mouse Monoclonal FLYWCH2 Antibody (OTI3G3) [Alexa Fluor 405]
NBP2-72341AF405 0.1 mL

Mouse Monoclonal FLYWCH2 Antibody (OTI3G3) [Alexa Fluor 405]

Sign In for Pricing
View Details
Bovine Epidermal growth factor receptor (EGFR) ELISA Kit
YP-W77578-01 48 Tests

Bovine Epidermal growth factor receptor (EGFR) ELISA Kit

Sign In for Pricing
View Details
Bovine Epidermal growth factor receptor (EGFR) ELISA Kit
YP-W77578-02 96 Tests

Bovine Epidermal growth factor receptor (EGFR) ELISA Kit

Sign In for Pricing
View Details