Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Fin bud initiation factor homolog (Fibin)

Product Specifications

Abbreviation

Recombinant Mouse Fibin protein

Gene Name

Fibin

UniProt

Q9CQS3

Expression Region

19-217aa

Organism

Mus musculus (Mouse)

Target Sequence

YFDGPLYPEMSNGTLHHYFVPDGDYEENDDPEKCQLLFRVSDRRRCSQGEGGQASSLLSLTLREEFTVLGRQVEDAGRVLEGISKSISYDLDGEESYGKYLRRESHQIGDAYSNSDKSLTELESKFKQGQEQDSRQESRLNEDFLGMLVHTRSLLKETLDISVGLRDKYELLAHTIRSHGTRLGRLKSDYLEGGAQKTG

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

Baculovirus

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

26.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Alkbh5 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K3245005 3x 1.0 µg

Alkbh5 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
OSBPL11 Mouse Monoclonal Antibody [Clone ID: OTI7B3]
TA501976S 30 µL

OSBPL11 Mouse Monoclonal Antibody [Clone ID: OTI7B3]

Sign In for Pricing
View Details
KRT8P26 sgRNA CRISPR Lentivector (Human) (Target 3)
K1168404 1.0 µg DNA

KRT8P26 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Progesterone EP Impurity I
RM-P156509-01 10 mg

Progesterone EP Impurity I

Sign In for Pricing
View Details
Progesterone EP Impurity I
RM-P156509-02 25 mg

Progesterone EP Impurity I

Sign In for Pricing
View Details
Progesterone EP Impurity I
RM-P156509-03 50 mg

Progesterone EP Impurity I

Sign In for Pricing
View Details