Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD14, Rat (HEK293, His)

The CD14 protein acts as a coreceptor for bacterial lipopolysaccharide (LPS), forming a complex with LY96 and TLR4. It binds monomeric LPS to LBP, delivers it to the LY96/TLR4 complex and initiates an immune response. CD14 Protein, Rat (HEK293, His) is the recombinant rat-derived CD14 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD14 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd14-protein-rat-hek293-his.html

Purity

98.0

Smiles

SPATPEPCELDQDEESVRCYCNFSDPQPNWSSAFLCAGAEDVEFYGGGRSLEYLLKRVDTEANLGQYTDIIRSLPLKRLTVRSARVPTQILFGTLRVLGYSGLRELTLENLEVTGTALSPLLDATGPDLNTLSLRNVSWATTDTWLAELQQWLKPGLKVLSIAQAHSLNFSCKQVGVFPALATLDLSDNPELGEKGLISALCPHKFPTLQVLALRNAGMETTSGVCSALAAARVPLQALDLSHNSLRDTAGTPSCDWPSQLNSLNLSFTGLEHVPKGLPAKLSVLDLSYNRLDRKPRPEELPEVGSLSLTGNPFLHSESQSEAY

Molecular Formula

60350 (Gene_ID) Q63691 (S18-Y341) (Accession)

Molecular Weight

Approximately 45-57 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NR2E3 (NM_016346) Human Recombinant Protein
TP320677L 1 mg

NR2E3 (NM_016346) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant Human STAT3 Protein (GST Tag)
PDEH100640-01 20 µg

Recombinant Human STAT3 Protein (GST Tag)

Sign In for Pricing
View Details
Recombinant Human STAT3 Protein (GST Tag)
PDEH100640-02 100 µg

Recombinant Human STAT3 Protein (GST Tag)

Sign In for Pricing
View Details
Recombinant Human STAT3 Protein (GST Tag)
PDEH100640-03 500 µg

Recombinant Human STAT3 Protein (GST Tag)

Sign In for Pricing
View Details
Recombinant Human STAT3 Protein (GST Tag)
PDEH100640-04 1 mg

Recombinant Human STAT3 Protein (GST Tag)

Sign In for Pricing
View Details
DEAC-dUTP, lyophilized powder
#40059 1x 25 nmol

DEAC-dUTP, lyophilized powder

Sign In for Pricing
View Details