Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Chemerin/RARRES2, Human (HEK293, His)

Chemerin/RARRES2 protein is an adipokine secreted by adipocytes that is activated by CMKLR1 and serves as a CMKLR2 ligand to complexly regulate adipogenesis, metabolism, and inflammation. It actively regulates adipocyte differentiation, affects lipid and glucose metabolism, and plays a role in angiogenesis. Chemerin/RARRES2 Protein, Human (HEK293, His) is the recombinant human-derived Chemerin/RARRES2 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Chemerin/RARRES2 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/chemerin-protein-human-hek-293-his.html

Purity

98.0

Smiles

ELTEAQRRGLQVALEEFHKHPPVQWAFQETSVESAVDTPFPAGIFVRLEFKLQQTSCRKRDWKKPECKVRPNGRKRKCLACIKLGSEDKVLGRLVHCPIETQVLREAEEHQETQCLRVQRAGEDPHSFYFPGQFAFS

Molecular Formula

5919 (Gene_ID) Q99969 (E21-S157) (Accession)

Molecular Weight

Approximately 16-20 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal FGF-23 Antibody (FGF23/4168) [Alexa Fluor 750]
NBP3-08383AF750 100 µL

Mouse Monoclonal FGF-23 Antibody (FGF23/4168) [Alexa Fluor 750]

Sign In for Pricing
View Details
ANKRD6 Polyclonal Antibody, PE-Cy7 Conjugated
bs-8728R-PE-Cy7 100 µL

ANKRD6 Polyclonal Antibody, PE-Cy7 Conjugated

Sign In for Pricing
View Details
Mouse Hgsnat qPCR Primer Pair
QM26506S 200 Tests

Mouse Hgsnat qPCR Primer Pair

Sign In for Pricing
View Details
Recombinant Human TMPRSS2 protein
TMPRSS2-01H 10 µg

Recombinant Human TMPRSS2 protein

Sign In for Pricing
View Details
SPCS1 (NM_014041) Human Over-expression Lysate
E45H08995-2 20 µg

SPCS1 (NM_014041) Human Over-expression Lysate

Sign In for Pricing
View Details
Procalcitonin (PCT) Mouse mAb
E47M41144 100 µL

Procalcitonin (PCT) Mouse mAb

Sign In for Pricing
View Details