Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VSIG8, Mouse (HEK293, His, solution)

VSIG8 Protein, Mouse (HEK293, His, solution) is the recombinant mouse-derived VSIG8 protein, expressed by HEK293, with C-6*His labeled tag.

Product Specifications

Product Name Alternative

VSIG8 Protein, Mouse (HEK293, His, solution), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/vsig8-protein-mouse-hek-293-his.html

Purity

95.00

Smiles

VRINGDGQEVMYLAEGDNVRLGCPYLLDPEDLGTNSLDIEWMQVNSEPSHRENVFLTYQDKRIGHGNLPHLQQRVRFAASDPSQYDASINLMNLQVSDTATYECRVKKTTMATRKVIVTVQARPAVPMCWTEGHMSKGNDVVLKCFANGGSQPLSYKWAKISGHSHPYRAGAYHSQHSFHSELSYQESFHSTINQGLGNGDLLLKGINADDDGLYQCTVANHVGYSVCVVEVKVSDSQRVG

Molecular Formula

240916 (Gene_ID) Q6P3A4-1 (V22-G262) (Accession)

Molecular Weight

Approximately 28.0 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TIR1 Antibody
KC-8678-01 50 μL

TIR1 Antibody

Sign In for Pricing
View Details
TIR1 Antibody
KC-8678-02 100 µL

TIR1 Antibody

Sign In for Pricing
View Details
TIR1 Antibody
KC-8678-03 1 mL

TIR1 Antibody

Sign In for Pricing
View Details
XPA (C-term) Rabbit Polyclonal Antibody
AP18245PU-N 400 µL

XPA (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GTF2H2 (NM_001515) Human Over-expression Lysate
LC419885 20 µg

GTF2H2 (NM_001515) Human Over-expression Lysate

Sign In for Pricing
View Details
Human OBFC1 (STN1) activation kit by CRISPRa
GA112776 1 Kit

Human OBFC1 (STN1) activation kit by CRISPRa

Sign In for Pricing
View Details