Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VSIG8, Mouse (HEK293, His, solution)

VSIG8 Protein, Mouse (HEK293, His, solution) is the recombinant mouse-derived VSIG8 protein, expressed by HEK293, with C-6*His labeled tag.

Product Specifications

Product Name Alternative

VSIG8 Protein, Mouse (HEK293, His, solution), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/vsig8-protein-mouse-hek-293-his.html

Purity

95.00

Smiles

VRINGDGQEVMYLAEGDNVRLGCPYLLDPEDLGTNSLDIEWMQVNSEPSHRENVFLTYQDKRIGHGNLPHLQQRVRFAASDPSQYDASINLMNLQVSDTATYECRVKKTTMATRKVIVTVQARPAVPMCWTEGHMSKGNDVVLKCFANGGSQPLSYKWAKISGHSHPYRAGAYHSQHSFHSELSYQESFHSTINQGLGNGDLLLKGINADDDGLYQCTVANHVGYSVCVVEVKVSDSQRVG

Molecular Formula

240916 (Gene_ID) Q6P3A4-1 (V22-G262) (Accession)

Molecular Weight

Approximately 28.0 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

E-Cadherin (CDH1) / CD324 (Intercellular Junction Marker) (rCDH1/1525), CF594 conjugate, 0.1mg/mL
BNC942067-100 1x 100 µL

E-Cadherin (CDH1) / CD324 (Intercellular Junction Marker) (rCDH1/1525), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CCNK Rabbit Polyclonal Antibody
TA374389 100 µL

CCNK Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD56 / NCAM (123A8, same as 56C04), Biotin conjugate, 0.1mg/mL
BNCB0692-500 1x 500 µL

CD56 / NCAM (123A8, same as 56C04), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
3-Cyano-7-hydroxycoumarin *CAS 19088-73-4*
40-AAT 25 mg

3-Cyano-7-hydroxycoumarin *CAS 19088-73-4*

Sign In for Pricing
View Details
PTGR1 (NM_001146108) Human Recombinant Protein
TP328825M 100 µg

PTGR1 (NM_001146108) Human Recombinant Protein

Sign In for Pricing
View Details
Potassium Cyanate
TRC-P695065-50G 50 g

Potassium Cyanate

Sign In for Pricing
View Details