Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VSIG8, Mouse (HEK293, His, solution)

VSIG8 Protein, Mouse (HEK293, His, solution) is the recombinant mouse-derived VSIG8 protein, expressed by HEK293, with C-6*His labeled tag.

Product Specifications

Product Name Alternative

VSIG8 Protein, Mouse (HEK293, His, solution), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/vsig8-protein-mouse-hek-293-his.html

Purity

95.00

Smiles

VRINGDGQEVMYLAEGDNVRLGCPYLLDPEDLGTNSLDIEWMQVNSEPSHRENVFLTYQDKRIGHGNLPHLQQRVRFAASDPSQYDASINLMNLQVSDTATYECRVKKTTMATRKVIVTVQARPAVPMCWTEGHMSKGNDVVLKCFANGGSQPLSYKWAKISGHSHPYRAGAYHSQHSFHSELSYQESFHSTINQGLGNGDLLLKGINADDDGLYQCTVANHVGYSVCVVEVKVSDSQRVG

Molecular Formula

240916 (Gene_ID) Q6P3A4-1 (V22-G262) (Accession)

Molecular Weight

Approximately 28.0 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD9 Human Gene Knockout Kit (CRISPR)
KN202000BN 1 Kit

CD9 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SPRR2F (NM_001014450) Human Over-expression Lysate
LY423073 100 µg

SPRR2F (NM_001014450) Human Over-expression Lysate

Sign In for Pricing
View Details
Human DR3/TNFRSF25 Recombinant Rabbit monoclonal Antibody
HA723869 100 µL

Human DR3/TNFRSF25 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Human RUFY4 activation kit by CRISPRa
GA117197 1 Kit

Human RUFY4 activation kit by CRISPRa

Sign In for Pricing
View Details
N,N-Diethyl-2-phenylbutanamide
TRC-E903330-50MG 50 mg

N,N-Diethyl-2-phenylbutanamide

Sign In for Pricing
View Details
AF/LE Purified Anti-Human CD85j Antibody[GHI/75]
AN002890-01 100 µg

AF/LE Purified Anti-Human CD85j Antibody[GHI/75]

Sign In for Pricing
View Details