Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Interleukin-13 (Il13), partial (Active)

Product Specifications

Product Name Alternative

Interleukin-13; IL-13; T-Cell Activation Protein P600; Il13; Il-13

Abbreviation

Recombinant Mouse Il13 protein, partial (Active)

Gene Name

Il13

UniProt

P20109

Expression Region

22-131aa

Organism

Mus musculus (Mouse)

Target Sequence

PVPRSVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTVSSLPDTKIEVAHFITKLLSYTKQLFRHGPF

Tag

C-terminal 6xHis-tagged

Type

Active Protein & In Stock Protein

Source

Mammalian cell

Field of Research

Immunology

Relevance

Mouse interleukin 13 (mIL-13) is a pleiotropic cytokine produced by activated Th2 cells. IL-13 induces B cell proliferation and immunoglobin production. It contains a four helical bundle with two internal disulfide bonds. Mouse IL13 shares 58% sequence identity with human protein and exhibits cross-species activity. IL13 signals via receptor IL13R (type2, IL4R) and activates STAT-6. IL13 initially binds IL-13Rα1 with low affinity and triggers association of IL4Rα, generating a high affinity heterodimeric receptor IL13R and eliciting downstream signals. IL13 also binds IL-13Rα2 with high affinity, which plays a role in a negative feedback system of IL13 signaling. IL13 is an important mediator of allergic inflammation and disease.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

The ED50 as determined in a cell proliferation assay using TF‑1 human erythroleukemic cells is 11.34 ng/ml.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Cytokine. Inhibits inflammatory cytokine production. Synergizes with IL2 in regulating interferon-gamma synthesis. May be critical in regulating inflammatory and immune responses (By similarity) . Positively regulates IL31RA expression in macrophages

Molecular Weight

13.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Naepaine hydrochloride
T33578-01 100 mg

Naepaine hydrochloride

Sign In for Pricing
View Details
Naepaine hydrochloride
T33578-02 25 mg

Naepaine hydrochloride

Sign In for Pricing
View Details
Naepaine hydrochloride
T33578-03 50 mg

Naepaine hydrochloride

Sign In for Pricing
View Details
Brk (PTK6) CytoSection
TS407766P5 25 Slides

Brk (PTK6) CytoSection

Sign In for Pricing
View Details
NF-L Mouse Monoclonal Antibody
orb1152030-01 1 Each

NF-L Mouse Monoclonal Antibody

Sign In for Pricing
View Details
NF-L Mouse Monoclonal Antibody
orb1152030-02 100 µg

NF-L Mouse Monoclonal Antibody

Sign In for Pricing
View Details