Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHST15, Human (HEK293, His)

The CHST15 protein is a sulfotransferase that catalyzes the transfer of sulfate to GalNAc 4-sulfate in chondroitin sulfate A to form chondroitin sulfate E with GlcA-GalNAc (4,6-SO (4) ) units. It also sulfates the unique non-reducing terminal sequence GalNAc (4SO4) -GlcA (2SO4) -GalNAc (6SO4), similar to thrombomodulin chondroitin sulfate. CHST15 Protein, Human (HEK293, His) is the recombinant human-derived CHST15 protein, expressed by HEK293 , with N-His labeled tag.

Product Specifications

Product Name Alternative

CHST15 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/chst15-protein-human-hek293-his.html

Purity

96.00

Smiles

SGAHQELLISSPFHYGGFPSNPSLMDSENPSDTKEHHHQSSVNNISYMKDYPSIKLIINSITTRIEFTTRQLPDLEDLKKQELHMFSVIPNKFLPNSKSPCWYEEFSGQNTTDPYLTNSYVLYSKRFRSTFDALRKAFWGHLAHAHGKHFRLRCLPHFYIIGQPKCGTTDLYDRLRLHPEVKFSAIKEPHWWTRKRFGIVRLRDGLRDRYPVEDYLDLFDLAAHQIHQGLQASSAKEQSKMNTIIIGEASASTMWDNNAWTFFYDNSTDGEPPFLTQDFIHAFQPNARLIVMLRDPVERLYSDYLYFASSNKSADDFHEKVTEALQLFENCMLDYSLRACVYNNTLNNAMPVRLQVGLYAVYLLDWLSVFDKQQFLILRLEDHASNVKYTMHKVFQFLNLGPLSEKQEALMTKSPASNARRPEDRNLGPMWPITQKILRDFYRPFNARLAQVLADEAFAWKTT

Molecular Formula

51363 (Gene_ID) Q7LFX5-1 (S99-T561) (Accession)

Molecular Weight

Approximately 70-90 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-STIM1 monoclonal antibody, clone TE1925
DCABH-164 100 ul

Rabbit Anti-STIM1 monoclonal antibody, clone TE1925

Sign In for Pricing
View Details
Rabbit Polyclonal PDCD6 Antibody
NBP2-94061-0.02mL 0.02 mL

Rabbit Polyclonal PDCD6 Antibody

Sign In for Pricing
View Details
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) ZEU1 Polyclonal Antibody
MBS7147264 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) ZEU1 Polyclonal Antibody

Sign In for Pricing
View Details
Lrig1 Mouse siRNA Oligo Duplex (Locus ID 16206)
SR422034 1 Kit

Lrig1 Mouse siRNA Oligo Duplex (Locus ID 16206)

Sign In for Pricing
View Details
Human RPC8 Antibody
33465-05111 150 µg

Human RPC8 Antibody

Sign In for Pricing
View Details
XKR6 Adenovirus (Mouse)
50526054 1.0 mL

XKR6 Adenovirus (Mouse)

Sign In for Pricing
View Details