Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHST15, Human (HEK293, His)

The CHST15 protein is a sulfotransferase that catalyzes the transfer of sulfate to GalNAc 4-sulfate in chondroitin sulfate A to form chondroitin sulfate E with GlcA-GalNAc (4,6-SO (4) ) units. It also sulfates the unique non-reducing terminal sequence GalNAc (4SO4) -GlcA (2SO4) -GalNAc (6SO4), similar to thrombomodulin chondroitin sulfate. CHST15 Protein, Human (HEK293, His) is the recombinant human-derived CHST15 protein, expressed by HEK293 , with N-His labeled tag.

Product Specifications

Product Name Alternative

CHST15 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/chst15-protein-human-hek293-his.html

Purity

96.00

Smiles

SGAHQELLISSPFHYGGFPSNPSLMDSENPSDTKEHHHQSSVNNISYMKDYPSIKLIINSITTRIEFTTRQLPDLEDLKKQELHMFSVIPNKFLPNSKSPCWYEEFSGQNTTDPYLTNSYVLYSKRFRSTFDALRKAFWGHLAHAHGKHFRLRCLPHFYIIGQPKCGTTDLYDRLRLHPEVKFSAIKEPHWWTRKRFGIVRLRDGLRDRYPVEDYLDLFDLAAHQIHQGLQASSAKEQSKMNTIIIGEASASTMWDNNAWTFFYDNSTDGEPPFLTQDFIHAFQPNARLIVMLRDPVERLYSDYLYFASSNKSADDFHEKVTEALQLFENCMLDYSLRACVYNNTLNNAMPVRLQVGLYAVYLLDWLSVFDKQQFLILRLEDHASNVKYTMHKVFQFLNLGPLSEKQEALMTKSPASNARRPEDRNLGPMWPITQKILRDFYRPFNARLAQVLADEAFAWKTT

Molecular Formula

51363 (Gene_ID) Q7LFX5-1 (S99-T561) (Accession)

Molecular Weight

Approximately 70-90 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Interleukin 8 (IL8) Instant BioAssayTM ELISA Kit (Canine)
517369 96 Tests

Interleukin 8 (IL8) Instant BioAssayTM ELISA Kit (Canine)

Sign In for Pricing
View Details
Anti-Human GGPS1 Polyclonal Antibody
PHB73201 100 μg

Anti-Human GGPS1 Polyclonal Antibody

Sign In for Pricing
View Details
SLC25A43 AAV siRNA Pooled Vector
44033161 1.0 µg

SLC25A43 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
H3f3b (Histone H33, H3f3a, H33a) (MaxLight 650) discontinued
302481-ML650 100 µL

H3f3b (Histone H33, H3f3a, H33a) (MaxLight 650) discontinued

Sign In for Pricing
View Details
IRF1-AS1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4B11]
TA811508AM 100 µL

IRF1-AS1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4B11]

Sign In for Pricing
View Details
Sieve 100micron 100mm diameter
SXMT115 1 Each

Sieve 100micron 100mm diameter

Sign In for Pricing
View Details