Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHST15, Human (HEK293, His)

The CHST15 protein is a sulfotransferase that catalyzes the transfer of sulfate to GalNAc 4-sulfate in chondroitin sulfate A to form chondroitin sulfate E with GlcA-GalNAc (4,6-SO (4) ) units. It also sulfates the unique non-reducing terminal sequence GalNAc (4SO4) -GlcA (2SO4) -GalNAc (6SO4), similar to thrombomodulin chondroitin sulfate. CHST15 Protein, Human (HEK293, His) is the recombinant human-derived CHST15 protein, expressed by HEK293 , with N-His labeled tag.

Product Specifications

Product Name Alternative

CHST15 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/chst15-protein-human-hek293-his.html

Purity

96.00

Smiles

SGAHQELLISSPFHYGGFPSNPSLMDSENPSDTKEHHHQSSVNNISYMKDYPSIKLIINSITTRIEFTTRQLPDLEDLKKQELHMFSVIPNKFLPNSKSPCWYEEFSGQNTTDPYLTNSYVLYSKRFRSTFDALRKAFWGHLAHAHGKHFRLRCLPHFYIIGQPKCGTTDLYDRLRLHPEVKFSAIKEPHWWTRKRFGIVRLRDGLRDRYPVEDYLDLFDLAAHQIHQGLQASSAKEQSKMNTIIIGEASASTMWDNNAWTFFYDNSTDGEPPFLTQDFIHAFQPNARLIVMLRDPVERLYSDYLYFASSNKSADDFHEKVTEALQLFENCMLDYSLRACVYNNTLNNAMPVRLQVGLYAVYLLDWLSVFDKQQFLILRLEDHASNVKYTMHKVFQFLNLGPLSEKQEALMTKSPASNARRPEDRNLGPMWPITQKILRDFYRPFNARLAQVLADEAFAWKTT

Molecular Formula

51363 (Gene_ID) Q7LFX5-1 (S99-T561) (Accession)

Molecular Weight

Approximately 70-90 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mroh2a (NM_001281466) Mouse Tagged ORF Clone
MR231858 10 µg

Mroh2a (NM_001281466) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
TMEM71 Protein Vector (Mouse) (pPM-C-HA)
47085024 500 ng

TMEM71 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Aryl hydrocarbon Receptor (AHR) Human siRNA Oligo Duplex (Locus ID 196)
SR319302 1 Kit

Aryl hydrocarbon Receptor (AHR) Human siRNA Oligo Duplex (Locus ID 196)

Sign In for Pricing
View Details
TWEAK (Human) LumiAb ELISA Kit
MBS9510824-01 1 Kit

TWEAK (Human) LumiAb ELISA Kit

Sign In for Pricing
View Details
TWEAK (Human) LumiAb ELISA Kit
MBS9510824-02 5x 1 Kit

TWEAK (Human) LumiAb ELISA Kit

Sign In for Pricing
View Details
ASSP7 sgRNA CRISPR Lentivector set (Human)
K0137401 3x 1.0 µg

ASSP7 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details