Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHST15, Human (HEK293, His)

The CHST15 protein is a sulfotransferase that catalyzes the transfer of sulfate to GalNAc 4-sulfate in chondroitin sulfate A to form chondroitin sulfate E with GlcA-GalNAc (4,6-SO (4) ) units. It also sulfates the unique non-reducing terminal sequence GalNAc (4SO4) -GlcA (2SO4) -GalNAc (6SO4), similar to thrombomodulin chondroitin sulfate. CHST15 Protein, Human (HEK293, His) is the recombinant human-derived CHST15 protein, expressed by HEK293 , with N-His labeled tag.

Product Specifications

Product Name Alternative

CHST15 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/chst15-protein-human-hek293-his.html

Purity

96.00

Smiles

SGAHQELLISSPFHYGGFPSNPSLMDSENPSDTKEHHHQSSVNNISYMKDYPSIKLIINSITTRIEFTTRQLPDLEDLKKQELHMFSVIPNKFLPNSKSPCWYEEFSGQNTTDPYLTNSYVLYSKRFRSTFDALRKAFWGHLAHAHGKHFRLRCLPHFYIIGQPKCGTTDLYDRLRLHPEVKFSAIKEPHWWTRKRFGIVRLRDGLRDRYPVEDYLDLFDLAAHQIHQGLQASSAKEQSKMNTIIIGEASASTMWDNNAWTFFYDNSTDGEPPFLTQDFIHAFQPNARLIVMLRDPVERLYSDYLYFASSNKSADDFHEKVTEALQLFENCMLDYSLRACVYNNTLNNAMPVRLQVGLYAVYLLDWLSVFDKQQFLILRLEDHASNVKYTMHKVFQFLNLGPLSEKQEALMTKSPASNARRPEDRNLGPMWPITQKILRDFYRPFNARLAQVLADEAFAWKTT

Molecular Formula

51363 (Gene_ID) Q7LFX5-1 (S99-T561) (Accession)

Molecular Weight

Approximately 70-90 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human 20S Proteasome MAb (Clone 863425)
MAB95541-SP 25 µg

Human 20S Proteasome MAb (Clone 863425)

Sign In for Pricing
View Details
OR1I1, NT (OR1I1, Olfactory receptor 1I1, Olfactory receptor 19-20) (AP)
MBS6328195-01 0.2 mL

OR1I1, NT (OR1I1, Olfactory receptor 1I1, Olfactory receptor 19-20) (AP)

Sign In for Pricing
View Details
OR1I1, NT (OR1I1, Olfactory receptor 1I1, Olfactory receptor 19-20) (AP)
MBS6328195-02 5x 0.2 mL

OR1I1, NT (OR1I1, Olfactory receptor 1I1, Olfactory receptor 19-20) (AP)

Sign In for Pricing
View Details
SNORD126-set siRNA/shRNA/RNAi Lentivector (Human)
44819091 4x 500 ng

SNORD126-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
Human Phospho-NFATC1 (S172) MAb (Clone 679340)
MAB5640-SP 25 µg

Human Phospho-NFATC1 (S172) MAb (Clone 679340)

Sign In for Pricing
View Details
OR1P1 sgRNA CRISPR Lentivector (Human) (Target 3)
K1489004 1.0 µg DNA

OR1P1 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details