Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHST15, Human (HEK293, His)

The CHST15 protein is a sulfotransferase that catalyzes the transfer of sulfate to GalNAc 4-sulfate in chondroitin sulfate A to form chondroitin sulfate E with GlcA-GalNAc (4,6-SO (4) ) units. It also sulfates the unique non-reducing terminal sequence GalNAc (4SO4) -GlcA (2SO4) -GalNAc (6SO4), similar to thrombomodulin chondroitin sulfate. CHST15 Protein, Human (HEK293, His) is the recombinant human-derived CHST15 protein, expressed by HEK293 , with N-His labeled tag.

Product Specifications

Product Name Alternative

CHST15 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/chst15-protein-human-hek293-his.html

Purity

96.00

Smiles

SGAHQELLISSPFHYGGFPSNPSLMDSENPSDTKEHHHQSSVNNISYMKDYPSIKLIINSITTRIEFTTRQLPDLEDLKKQELHMFSVIPNKFLPNSKSPCWYEEFSGQNTTDPYLTNSYVLYSKRFRSTFDALRKAFWGHLAHAHGKHFRLRCLPHFYIIGQPKCGTTDLYDRLRLHPEVKFSAIKEPHWWTRKRFGIVRLRDGLRDRYPVEDYLDLFDLAAHQIHQGLQASSAKEQSKMNTIIIGEASASTMWDNNAWTFFYDNSTDGEPPFLTQDFIHAFQPNARLIVMLRDPVERLYSDYLYFASSNKSADDFHEKVTEALQLFENCMLDYSLRACVYNNTLNNAMPVRLQVGLYAVYLLDWLSVFDKQQFLILRLEDHASNVKYTMHKVFQFLNLGPLSEKQEALMTKSPASNARRPEDRNLGPMWPITQKILRDFYRPFNARLAQVLADEAFAWKTT

Molecular Formula

51363 (Gene_ID) Q7LFX5-1 (S99-T561) (Accession)

Molecular Weight

Approximately 70-90 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPIHBP1 Protein Vector (Rat) (pPM-C-HA)
PV270992 500 ng

GPIHBP1 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
ZM223 1mg
A17174-1 1 mg

ZM223 1mg

Sign In for Pricing
View Details
Recombinant Caenorhabditis Elegans trx-1 Protein (aa 1-115)
VAng-Ly3865-1mgEcoli 1 mg (E. coli)

Recombinant Caenorhabditis Elegans trx-1 Protein (aa 1-115)

Sign In for Pricing
View Details
Recombinant Fusobacterium nucleatum subsp.nucleatum ATP synthase subunit alpha (atpA)
MBS1280394-01 0.02 mg (E-Coli)

Recombinant Fusobacterium nucleatum subsp.nucleatum ATP synthase subunit alpha (atpA)

Sign In for Pricing
View Details
Recombinant Fusobacterium nucleatum subsp.nucleatum ATP synthase subunit alpha (atpA)
MBS1280394-02 0.02 mg (Yeast)

Recombinant Fusobacterium nucleatum subsp.nucleatum ATP synthase subunit alpha (atpA)

Sign In for Pricing
View Details
Recombinant Fusobacterium nucleatum subsp.nucleatum ATP synthase subunit alpha (atpA)
MBS1280394-03 0.1 mg (E-Coli)

Recombinant Fusobacterium nucleatum subsp.nucleatum ATP synthase subunit alpha (atpA)

Sign In for Pricing
View Details