Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHST15, Human (HEK293, His)

The CHST15 protein is a sulfotransferase that catalyzes the transfer of sulfate to GalNAc 4-sulfate in chondroitin sulfate A to form chondroitin sulfate E with GlcA-GalNAc (4,6-SO (4) ) units. It also sulfates the unique non-reducing terminal sequence GalNAc (4SO4) -GlcA (2SO4) -GalNAc (6SO4), similar to thrombomodulin chondroitin sulfate. CHST15 Protein, Human (HEK293, His) is the recombinant human-derived CHST15 protein, expressed by HEK293 , with N-His labeled tag.

Product Specifications

Product Name Alternative

CHST15 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/chst15-protein-human-hek293-his.html

Purity

96.00

Smiles

SGAHQELLISSPFHYGGFPSNPSLMDSENPSDTKEHHHQSSVNNISYMKDYPSIKLIINSITTRIEFTTRQLPDLEDLKKQELHMFSVIPNKFLPNSKSPCWYEEFSGQNTTDPYLTNSYVLYSKRFRSTFDALRKAFWGHLAHAHGKHFRLRCLPHFYIIGQPKCGTTDLYDRLRLHPEVKFSAIKEPHWWTRKRFGIVRLRDGLRDRYPVEDYLDLFDLAAHQIHQGLQASSAKEQSKMNTIIIGEASASTMWDNNAWTFFYDNSTDGEPPFLTQDFIHAFQPNARLIVMLRDPVERLYSDYLYFASSNKSADDFHEKVTEALQLFENCMLDYSLRACVYNNTLNNAMPVRLQVGLYAVYLLDWLSVFDKQQFLILRLEDHASNVKYTMHKVFQFLNLGPLSEKQEALMTKSPASNARRPEDRNLGPMWPITQKILRDFYRPFNARLAQVLADEAFAWKTT

Molecular Formula

51363 (Gene_ID) Q7LFX5-1 (S99-T561) (Accession)

Molecular Weight

Approximately 70-90 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PBP (PEBP1) (NM_002567) Human Tagged Lenti ORF Clone
RC206355L4 10 µg

PBP (PEBP1) (NM_002567) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
BM28 discontinued
533631-01 30ul

BM28 discontinued

Sign In for Pricing
View Details
BM28 discontinued
533631-02 100 µL

BM28 discontinued

Sign In for Pricing
View Details
Cytokeratin 18 (Cell Proliferation-inducing Gene 46 Protein, CK18, CYK18 Cytokeratin Endo B, K18, Keratin-18, Kerd, KRT18) (PE)
MBS6124113-01 0.1 mL

Cytokeratin 18 (Cell Proliferation-inducing Gene 46 Protein, CK18, CYK18 Cytokeratin Endo B, K18, Keratin-18, Kerd, KRT18) (PE)

Sign In for Pricing
View Details
Cytokeratin 18 (Cell Proliferation-inducing Gene 46 Protein, CK18, CYK18 Cytokeratin Endo B, K18, Keratin-18, Kerd, KRT18) (PE)
MBS6124113-02 5x 0.1 mL

Cytokeratin 18 (Cell Proliferation-inducing Gene 46 Protein, CK18, CYK18 Cytokeratin Endo B, K18, Keratin-18, Kerd, KRT18) (PE)

Sign In for Pricing
View Details
Compound NP-012857
MF-0029415-01 10mg

Compound NP-012857

Sign In for Pricing
View Details