Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD40L/CD154/TRAP, Mouse (HEK293, Fc)

CD40L (CD154; TRAP) is a ligand to CD40/TNFRSF5, acts function by generating a costimulatory signal that up-regulates IL-4 synthesis[1]. CD40L is specifically expressed on activated CD4+ T-lymphocytes and involves in activation of NF-κB/MAPK pathway[2][3]. CD40L also involves in B cell differentiation, maturation, and apoptosis[4]. CD40L in mouse, cleaved into 2 chains of membrane form (1-260 a.a.) and soluble form (112-260 a.a.) which serves as a ligand for integrins (ITGA5:ITGB1 and ITGAV:ITGB3) . CD40L/CD154/TRAP Protein, Mouse (HEK293, Fc) is expressed in HEK392 cells with N-terminal hFc-tag.

Product Specifications

Product Name Alternative

CD40L/CD154/TRAP Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd40l-cd154-trap-protein-mouse-hek293-fc.html

Purity

95.65

Smiles

GDEDPQIAAHVVSEANSNAASVLQWAKKGYYTMKSNLVMLENGKQLTVKREGLYYVYTQVTFCSNREPSSQRPFIVGLWLKPSSGSERILLKAANTHSSSQLCEQQSVHLGGVFELQAGASVFVNVTEASQVIHRVGFSSFGLLKL

Molecular Formula

21947 (Gene_ID) P27548 (G115-L260) (Accession)

Molecular Weight

Approximately 46.23 kDa

References & Citations

[1]Blotta MH, et al. Cross-linking of the CD40 ligand on human CD4+ T lymphocytes generates a costimulatory signal that up-regulates IL-4 synthesis. J Immunol. 1996 May 1;156 (9) :3133-40.|[2]Schwabe RF, et al. CD40 activates NF-kappa B and c-Jun N-terminal kinase and enhances chemokine secretion on activated human hepatic stellate cells. J Immunol. 2001 Jun 1;166 (11) :6812-9.|[3]Batlle A, et al. CD40 and B-cell receptor signalling induce MAPK family members that can either induce or repress Bcl-6 expression. Mol Immunol. 2009 May;46 (8-9) :1727-35.|[4]Mikolajczak SA, et al. The modulation of CD40 ligand signaling by transmembrane CD28 splice variant in human T cells. J Exp Med. 2004 Apr 5;199 (7) :1025-31.|[5]Takada YK, et al. Soluble CD40L activates soluble and cell-surface integrin αvβ3, α5β1, and α4β1 by binding to the allosteric ligand-binding site (site 2) . J Biol Chem. 2021 Jan-Jun;296:100399.|[6]Pietravalle F, et al. Human native soluble CD40L is a biologically active trimer, processed inside microsomes. J Biol Chem. 1996 Mar 15;271 (11) :5965-7.|[7]Rahman M, et al. Platelet-derived CD40L (CD154) mediates neutrophil upregulation of Mac-1 and recruitment in septic lung injury. Ann Surg. 2009 Nov;250 (5) :783-90.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD11c (HC1/1), CF680R conjugate, 0.1mg/mL
BNC810152-500 1x 500 µL

CD11c (HC1/1), CF680R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF740 conjugate, 0.1mg/mL
BNC741820-100 1x 100 µL

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (45M1), CF568 conjugate, 0.1mg/mL
BNC680031-500 1x 500 µL

Mucin 5AC (MUC5AC) (45M1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8 (K8/383), CF640R conjugate, 0.1mg/mL
BNC400383-500 1x 500 µL

Cytokeratin 8 (K8/383), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Epithelial Marker) (rMOC-31), CF594 conjugate, 0.1mg/mL
BNC941819-500 1x 500 µL

Ep-CAM / CD326 (Epithelial Marker) (rMOC-31), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8A (Cytotoxic- & Suppressor T-Cell Marker) (UCHT4), CF740 conjugate, 0.1mg/mL
BNC741628-100 1x 100 µL

CD8A (Cytotoxic- & Suppressor T-Cell Marker) (UCHT4), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details