Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD299, Human (HEK293, His-Flag)

CD299 protein showcases an unconventional genetic architecture with a non-canonical intron-exon splice junction, highlighting unique structural features. CD299 Protein, Human (HEK293, His-Flag) is the recombinant human-derived CD299 protein, expressed by HEK293 , with N-Flag, N-8*His labeled tag.

Product Specifications

Product Name Alternative

CD299 Protein, Human (HEK293, His-Flag), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd299-protein-human-hek-293-his-flag.html

Purity

95.0

Smiles

SKVPSSLSQEQSEQDAIYQNLTQLKAAVGELSEKSKLQEIYQELTQLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTELKAAVGELPEKSKLQEIYQELTQLKAAVGELPDQSKQQQIYQELTDLKTAFERLCRHCPKDWTFFQGNCYFMSNSQRNWHDSVTACQEVRAQLVVIKTAEEQNFLQLQTSRSNRFSWMGLSDLNQEGTWQWVDGSPLSPSFQRYWNSGEPNNSGNEDCAEFSGSGWNDNRCDVDNYWICKKPAACFRDE

Molecular Formula

10332 (Gene_ID) Q9H2X3-8 (S73-E376) (Accession)

Molecular Weight

35-40 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Fndc5 Pre-designed siRNA Set B
SI205163B 1 Each

Rat Fndc5 Pre-designed siRNA Set B

Sign In for Pricing
View Details
TNFSF13B (Tumor Necrosis Factor Ligand Superfamily Member 13B, B Lymphocyte Stimulator, BLyS, B Cell-activating Factor, BAFF, CD257, Dendritic Cell-derived TNF-like Molecule, DTL, TNF- and APOL-related Leukocyte Expressed Ligand 1, TALL1, TALL-1, THANK, TNFSF20, UNQ401/PRO738, ZTNF4) (Biotin)
134554-Biotin 100 µL

TNFSF13B (Tumor Necrosis Factor Ligand Superfamily Member 13B, B Lymphocyte Stimulator, BLyS, B Cell-activating Factor, BAFF, CD257, Dendritic Cell-derived TNF-like Molecule, DTL, TNF- and APOL-related Leukocyte Expressed Ligand 1, TALL1, TALL-1, THANK, TNFSF20, UNQ401/PRO738, ZTNF4) (Biotin)

Sign In for Pricing
View Details
Human Relaxin-3 (RLN3) ELISA Kit
KTE60790-01 48 Tests

Human Relaxin-3 (RLN3) ELISA Kit

Sign In for Pricing
View Details
Human Relaxin-3 (RLN3) ELISA Kit
KTE60790-02 96 Tests

Human Relaxin-3 (RLN3) ELISA Kit

Sign In for Pricing
View Details
Human Relaxin-3 (RLN3) ELISA Kit
KTE60790-03 5x 96 Tests

Human Relaxin-3 (RLN3) ELISA Kit

Sign In for Pricing
View Details
Human Relaxin-3 (RLN3) ELISA Kit
KTE60790-04 50x 96 Tests

Human Relaxin-3 (RLN3) ELISA Kit

Sign In for Pricing
View Details