CD299, Human (HEK293, His-Flag)
CD299 protein showcases an unconventional genetic architecture with a non-canonical intron-exon splice junction, highlighting unique structural features. CD299 Protein, Human (HEK293, His-Flag) is the recombinant human-derived CD299 protein, expressed by HEK293 , with N-Flag, N-8*His labeled tag.
Product Specifications
Product Name Alternative
CD299 Protein, Human (HEK293, His-Flag), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/cd299-protein-human-hek-293-his-flag.html
Purity
95.0
Smiles
SKVPSSLSQEQSEQDAIYQNLTQLKAAVGELSEKSKLQEIYQELTQLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTELKAAVGELPEKSKLQEIYQELTQLKAAVGELPDQSKQQQIYQELTDLKTAFERLCRHCPKDWTFFQGNCYFMSNSQRNWHDSVTACQEVRAQLVVIKTAEEQNFLQLQTSRSNRFSWMGLSDLNQEGTWQWVDGSPLSPSFQRYWNSGEPNNSGNEDCAEFSGSGWNDNRCDVDNYWICKKPAACFRDE
Molecular Formula
10332 (Gene_ID) Q9H2X3-8 (S73-E376) (Accession)
Molecular Weight
35-40 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
133450-ML750 100 µL
SLC25A6 (ADP/ATP Translocase 3, ADP, ATP Carrier Protein 3, ADP, ATP Carrier Protein, Isoform T2, ANT 2, Adenine Nucleotide Translocator 3, ANT 3, Solute Carrier Family 25 Member 6, ANT3, CDABP0051) (MaxLight 750) discontinued
Sign In for Pricing
View Details 
abx551794 96 Tests
Human Tubulin monoglycylase TTLL3 (TTLL3) ELISA Kit
Sign In for Pricing
View Details MBS6195488-01 0.1 mL
FGF21 (Fibroblast Growth Factor 21) (MaxLight 405)
Sign In for Pricing
View Details MBS6195488-02 5x 0.1 mL
FGF21 (Fibroblast Growth Factor 21) (MaxLight 405)
Sign In for Pricing
View Details MBS742669-01 48 Well
Bovine Fatty Acid Binding Protein 2, Intestinal ELISA Kit
Sign In for Pricing
View Details