Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD299, Human (HEK293, His-Flag)

CD299 protein showcases an unconventional genetic architecture with a non-canonical intron-exon splice junction, highlighting unique structural features. CD299 Protein, Human (HEK293, His-Flag) is the recombinant human-derived CD299 protein, expressed by HEK293 , with N-Flag, N-8*His labeled tag.

Product Specifications

Product Name Alternative

CD299 Protein, Human (HEK293, His-Flag), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd299-protein-human-hek-293-his-flag.html

Purity

95.0

Smiles

SKVPSSLSQEQSEQDAIYQNLTQLKAAVGELSEKSKLQEIYQELTQLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTELKAAVGELPEKSKLQEIYQELTQLKAAVGELPDQSKQQQIYQELTDLKTAFERLCRHCPKDWTFFQGNCYFMSNSQRNWHDSVTACQEVRAQLVVIKTAEEQNFLQLQTSRSNRFSWMGLSDLNQEGTWQWVDGSPLSPSFQRYWNSGEPNNSGNEDCAEFSGSGWNDNRCDVDNYWICKKPAACFRDE

Molecular Formula

10332 (Gene_ID) Q9H2X3-8 (S73-E376) (Accession)

Molecular Weight

35-40 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human ApoC2
MBS7621088-01 0.01 mg

Recombinant Human ApoC2

Sign In for Pricing
View Details
Recombinant Human ApoC2
MBS7621088-02 0.05 mg

Recombinant Human ApoC2

Sign In for Pricing
View Details
Recombinant Human ApoC2
MBS7621088-03 0.5 mg

Recombinant Human ApoC2

Sign In for Pricing
View Details
Recombinant Human ApoC2
MBS7621088-04 1 mg

Recombinant Human ApoC2

Sign In for Pricing
View Details
Recombinant Human ApoC2
MBS7621088-05 5x 1 mg

Recombinant Human ApoC2

Sign In for Pricing
View Details
Lentiviral human FN3K shRNA (UAS) - Lentiviral human FN3K shRNA (UAS) plasmid
GTR15327322 1 Vial

Lentiviral human FN3K shRNA (UAS) - Lentiviral human FN3K shRNA (UAS) plasmid

Sign In for Pricing
View Details