Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD299, Human (HEK293, His-Flag)

CD299 protein showcases an unconventional genetic architecture with a non-canonical intron-exon splice junction, highlighting unique structural features. CD299 Protein, Human (HEK293, His-Flag) is the recombinant human-derived CD299 protein, expressed by HEK293 , with N-Flag, N-8*His labeled tag.

Product Specifications

Product Name Alternative

CD299 Protein, Human (HEK293, His-Flag), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd299-protein-human-hek-293-his-flag.html

Purity

95.0

Smiles

SKVPSSLSQEQSEQDAIYQNLTQLKAAVGELSEKSKLQEIYQELTQLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTELKAAVGELPEKSKLQEIYQELTQLKAAVGELPDQSKQQQIYQELTDLKTAFERLCRHCPKDWTFFQGNCYFMSNSQRNWHDSVTACQEVRAQLVVIKTAEEQNFLQLQTSRSNRFSWMGLSDLNQEGTWQWVDGSPLSPSFQRYWNSGEPNNSGNEDCAEFSGSGWNDNRCDVDNYWICKKPAACFRDE

Molecular Formula

10332 (Gene_ID) Q9H2X3-8 (S73-E376) (Accession)

Molecular Weight

35-40 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RGD1566099 (NM_001108347) Rat Tagged ORF Clone Lentiviral Particle
RR209654L4V 200 µL

RGD1566099 (NM_001108347) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Acadsb Rat Pre-designed siRNA Set A
HY-RS26636 1 Set

Acadsb Rat Pre-designed siRNA Set A

Sign In for Pricing
View Details
Rabbit Polyclonal ISPD Antibody
NBP1-79722 100 µL

Rabbit Polyclonal ISPD Antibody

Sign In for Pricing
View Details
ACAD9 Antibody
E30AC2943 100 µL

ACAD9 Antibody

Sign In for Pricing
View Details
Invadolysin (LmLN) (NM_033029) Human Tagged ORF Clone Lentiviral Particle
RC212749L3V 200 µL

Invadolysin (LmLN) (NM_033029) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Phthalate Ionophore I
462553-01 50 mg

Phthalate Ionophore I

Sign In for Pricing
View Details