Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD299, Human (HEK293, His-Flag)

CD299 protein showcases an unconventional genetic architecture with a non-canonical intron-exon splice junction, highlighting unique structural features. CD299 Protein, Human (HEK293, His-Flag) is the recombinant human-derived CD299 protein, expressed by HEK293 , with N-Flag, N-8*His labeled tag.

Product Specifications

Product Name Alternative

CD299 Protein, Human (HEK293, His-Flag), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd299-protein-human-hek-293-his-flag.html

Purity

95.0

Smiles

SKVPSSLSQEQSEQDAIYQNLTQLKAAVGELSEKSKLQEIYQELTQLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTELKAAVGELPEKSKLQEIYQELTQLKAAVGELPDQSKQQQIYQELTDLKTAFERLCRHCPKDWTFFQGNCYFMSNSQRNWHDSVTACQEVRAQLVVIKTAEEQNFLQLQTSRSNRFSWMGLSDLNQEGTWQWVDGSPLSPSFQRYWNSGEPNNSGNEDCAEFSGSGWNDNRCDVDNYWICKKPAACFRDE

Molecular Formula

10332 (Gene_ID) Q9H2X3-8 (S73-E376) (Accession)

Molecular Weight

35-40 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPP2R1A (NM_014225) Human Untagged Clone
SC110980 10 µg

PPP2R1A (NM_014225) Human Untagged Clone

Sign In for Pricing
View Details
SH3BP4 (NM_014521) Human Untagged Clone
SC108606 10 µg

SH3BP4 (NM_014521) Human Untagged Clone

Sign In for Pricing
View Details
Mouse Monoclonal Siglec-7/CD328 Antibody (194211) [Janelia Fluor 525]
FAB11381JF525 0.1 mL

Mouse Monoclonal Siglec-7/CD328 Antibody (194211) [Janelia Fluor 525]

Sign In for Pricing
View Details
Xrcc1 Mouse shRNA Plasmid (Locus ID 22594)
TR502434 1 Kit

Xrcc1 Mouse shRNA Plasmid (Locus ID 22594)

Sign In for Pricing
View Details
RPUSD2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K2069507 1.0 µg DNA

RPUSD2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
LRRN1 Antibody, HRP conjugated
A58499-50UG 50 µg

LRRN1 Antibody, HRP conjugated

Sign In for Pricing
View Details