Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Matriptase/ST14 Catalytic Domain, Mouse (His)

The Matriptase/ST14 catalytic domain protein exhibits serine-type endopeptidase activity and is critical in processes as diverse as placental branching and neural tube closure. It is an extrinsic component of the plasma membrane and is expressed in structures such as the digestive system, early concepts, genitourinary system, pituitary gland, and sense organs. Matriptase/ST14 Catalytic Domain Protein, Mouse (His) is the recombinant mouse-derived Matriptase/ST14 Catalytic Domain protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Matriptase/ST14 Catalytic Domain Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/matriptase-st14-catalytic-domain-protein-mouse-his.html

Purity

97.00

Smiles

GSDEKNCDCGLRSFTKQARVVGGTNADEGEWPWQVSLHALGQGHLCGASLISPDWLVSAAHCFQDDKNFKYSDYTMWTAFLGLLDQSKRSASGVQELKLKRIITHPSFNDFTFDYDIALLELEKSVEYSTVVRPICLPDATHVFPAGKAIWVTGWGHTKEGGTGALILQKGEIRVINQTTCEDLMPQQITPRMMCVGFLSGGVDSCQGDSGGPLSSAEKDGRMFQAGVVSWGEGCAQRNKPGVYTRLPVVRDWIKEHTGV

Molecular Formula

19143 (Gene_ID) NP_035306 (G596-V855) (Accession)

Molecular Weight

Approximately 28 kDa (major) and minor auto-activation fragments

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Atl1 Mouse Gene Knockout Kit (CRISPR)
KN501746 1 Kit

Atl1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Thrombomodulin / CD141 (Endothelial Cell Marker) (THBD/1782), CF405S conjugate, 0.1mg/mL
BNC041782-500 1x 500 µL

Thrombomodulin / CD141 (Endothelial Cell Marker) (THBD/1782), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Calm2 (NM_007589) Mouse Tagged ORF Clone
MG201043 10 µg

Calm2 (NM_007589) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
ALDH6A1 Antibody
F40222-0.08ML 0.08 mL

ALDH6A1 Antibody

Sign In for Pricing
View Details
MALT1 Mouse Monoclonal Antibody [Clone ID: SPM578]
AM50100PU-S 100 µg

MALT1 Mouse Monoclonal Antibody [Clone ID: SPM578]

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS501721 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details