Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Matriptase/ST14 Catalytic Domain, Mouse (His)

The Matriptase/ST14 catalytic domain protein exhibits serine-type endopeptidase activity and is critical in processes as diverse as placental branching and neural tube closure. It is an extrinsic component of the plasma membrane and is expressed in structures such as the digestive system, early concepts, genitourinary system, pituitary gland, and sense organs. Matriptase/ST14 Catalytic Domain Protein, Mouse (His) is the recombinant mouse-derived Matriptase/ST14 Catalytic Domain protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Matriptase/ST14 Catalytic Domain Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/matriptase-st14-catalytic-domain-protein-mouse-his.html

Purity

97.00

Smiles

GSDEKNCDCGLRSFTKQARVVGGTNADEGEWPWQVSLHALGQGHLCGASLISPDWLVSAAHCFQDDKNFKYSDYTMWTAFLGLLDQSKRSASGVQELKLKRIITHPSFNDFTFDYDIALLELEKSVEYSTVVRPICLPDATHVFPAGKAIWVTGWGHTKEGGTGALILQKGEIRVINQTTCEDLMPQQITPRMMCVGFLSGGVDSCQGDSGGPLSSAEKDGRMFQAGVVSWGEGCAQRNKPGVYTRLPVVRDWIKEHTGV

Molecular Formula

19143 (Gene_ID) NP_035306 (G596-V855) (Accession)

Molecular Weight

Approximately 28 kDa (major) and minor auto-activation fragments

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

25-Hydroxy Cholesterol
TRC-H918030-25MG 25 mg

25-Hydroxy Cholesterol

Sign In for Pricing
View Details
4-Aminohippuric-d4 Acid
TRC-A627972-25MG 25 mg

4-Aminohippuric-d4 Acid

Sign In for Pricing
View Details
7-Benzoyloxindole
TRC-B208155-250MG 250 mg

7-Benzoyloxindole

Sign In for Pricing
View Details
TMEM121 Human Gene Knockout Kit (CRISPR)
KN401428 1 Kit

TMEM121 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Blocks, Kidney
CB533356 1 Block

Frozen Tissue Blocks, Kidney

Sign In for Pricing
View Details
IFluor® 514 goat anti-rabbit IgG (H+L) *Cross Adsorbed*
16829-AAT 1 mg

IFluor® 514 goat anti-rabbit IgG (H+L) *Cross Adsorbed*

Sign In for Pricing
View Details