Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF basic/bFGF, Human (154a.a)

FGF-2 is a member of the fibroblast family involved in bone healing, cartilage repair, bone repair, and nerve regeneration. FGF-2 is also a mitotic promoter that accelerates cell proliferation. FGF-2 regulates immune processes by specifically targeting tyrosine kinase receptors and activating the FGF/FGFR signaling pathway. For example, FGF-2 is involved in the JAK-STAT signaling pathway to regulate cartilage metabolism and also activates ERK signaling to promote cartilage regeneration. FGF-2 combined with FGFR1/3 promoted degeneration and repair of articular cartilage, respectively[1]. FGF-2 is also a known carcinogen in GBM, which contributes to glioma growth and vascularization[2].FGF basic/bFGF Protein, Human (154a.a), consists of 154 amino acids, produced by E.coli with tag free.

Product Specifications

Product Name Alternative

FGF basic/bFGF Protein, Human (154a.a), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Applications

COVID-19-immunoregulation

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-basic-bfgf-protein-human-154a-a.html

Purity

98.0

Smiles

AAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS

Molecular Formula

2247 (Gene_ID) P09038-4 (A135-S288) (Accession)

Molecular Weight

Approximately 15-18 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Westermann R, et al. Basic fibroblast growth factor (bFGF), a multifunctional growth factor for neuroectodermal cells. J Cell Sci Suppl. 1990;13:97-117.|[2]Rusnati M, et al. Interaction of angiogenic basic fibroblast growth factor with endothelial cell heparan sulfate proteoglycans. Biological implications in neovascularization. Int J Clin Lab Res. 1996;26 (1) :15-23.|[3]Zhang J, et al. FGF2: a key regulator augmenting tendon-to-bone healing and cartilage repair. Regen Med. 2020 Sep;15 (9) :2129-2142.|[4]Jimenez-Pascual A, et al. FGF2: a novel druggable target for glioblastoma? Expert Opin Ther Targets. 2020 Apr;24 (4) :311-318.|[5]Hankemeier S, et al. Modulation of proliferation and differentiation of human bone marrow stromal cells by fibroblast growth factor 2: potential implications for tissue engineering of tendons and ligaments. Tissue Eng. 2005 Jan-Feb;11 (1-2) :41-9.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD86 Antibody, HRP conjugated
A16671-100UG 100 µg

CD86 Antibody, HRP conjugated

Sign In for Pricing
View Details
pCR4-TOPO-ZNF418 Plasmid
PVT33484 2 µg

pCR4-TOPO-ZNF418 Plasmid

Sign In for Pricing
View Details
Anti-Arl13b Antibody FL650 Conjugate
75-287-FL650 200 µL

Anti-Arl13b Antibody FL650 Conjugate

Sign In for Pricing
View Details
Polyclonal USP8 Antibody
APR00419G 0.1mg

Polyclonal USP8 Antibody

Sign In for Pricing
View Details
LRG1 cDNA Clone
MBS1276911-01 0.01 mg Plasmid + 0.2 mL Glycerol-Stock

LRG1 cDNA Clone

Sign In for Pricing
View Details
LRG1 cDNA Clone
MBS1276911-02 5x 0.01 mg Plasmid + 5x 0.2 mL Glycerol-Stock

LRG1 cDNA Clone

Sign In for Pricing
View Details