Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Erythropoietin receptor (Epor), partial

Product Specifications

Product Name Alternative

(EPO-R)

Abbreviation

Recombinant Rat Epor protein, partial

Gene Name

Epor

UniProt

Q07303

Expression Region

25-249aa

Organism

Rattus norvegicus (Rat)

Target Sequence

ASSPSLPDPKFESKAALLASRGSEELLCFTQRLEDLVCFWEEAANSGMGFNYSFSYQLEGESRKSCRLHQAPTVRGSMRFWCSLPTADTSSFVPLELQVTEASGSPRYHRIIHINEVVLLDAPAGLLARRAEEGSHVVLRWLPPPGAPMTTHIRYEVDVSAGNRAGGTQRVEVLEGRTECVLSNLRGGTRYTFAVRARMAEPSFSGFWSAWSEPASLLTASDLDP

Tag

C-terminal 10xHis-tagged

Type

In Stock Protein

Source

Mammalian cell

Field of Research

Cardiovascular

Relevance

Receptor for erythropoietin. Mediates erythropoietin-induced erythroblast proliferation and differentiation. Upon EPO stimulation, EPOR dimerizes triggering the JAK2/STAT5 signaling cascade. In some cell types, can also activate STAT1 and STAT3. May also activate LYN tyrosine kinase.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

27.5 kDa

References & Citations

"Alternative splicing of the erythropoietin receptor gene correlates with erythroid differentiation in rat hematopoietic and leukemic cells." Fujita M., Takahashi R., Kitada K., Watanabe R., Kitazawa S., Ashoori F., Liang P., Saya H., Serikawa T., Maeda S. Cancer Lett. 112:47-55 (1997)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Catalase (CAT) Activity Fluorometric Assay Kit
E-BC-F006 96 T (40 samples)

Catalase (CAT) Activity Fluorometric Assay Kit

Sign In for Pricing
View Details
Col16a1 Mouse Gene Knockout Kit (CRISPR)
KN503620 1 Kit

Col16a1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant KCTD21 Antibody
RC-4544-01 50 μL

Recombinant KCTD21 Antibody

Sign In for Pricing
View Details
Recombinant KCTD21 Antibody
RC-4544-02 100 µL

Recombinant KCTD21 Antibody

Sign In for Pricing
View Details
Recombinant KCTD21 Antibody
RC-4544-03 1 mL

Recombinant KCTD21 Antibody

Sign In for Pricing
View Details
FOXP3 (FXP3/197), 0.2mg/mL
BNUB0197-500 1x 500 µL

FOXP3 (FXP3/197), 0.2mg/mL

Sign In for Pricing
View Details