Animal-Free IL-22, Mouse (His)
IL-22 Protein is an secreted IL-10 family cytokine that take part in inflammation responses, reactive oxygen species metabolic process as well as the regeneration and spreading of epithelial cells. IL22 promotes cell survival and proliferation through STAT3, ERK1/2, MAPK and PI3K/AKT pathways. Animal-Free IL-22 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-22 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.
Product Specifications
Product Name Alternative
Animal-Free IL-22 Protein, Mouse (His), Mouse, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/animal-free-il-22-protein-mouse-his.html
Purity
95.0
Smiles
MLPVNTRCKLEVSNFQQPYIVNRTFMLAKEASLADNNTDVRLIGEKLFRGVSAKDQCYLMKQVLNFTLEDVLLPQSDRFQPYMQEVVPFLTKLSNQLSSCHISGDDQNIQKNVRRLKETVKKLGESGEIKAIGELDLLFMSLRNACV
Molecular Formula
50929 (Gene_ID) Q9JJY9 (L34-V179) (Accession)
Molecular Weight
Approximately 17 kDa, based on SDS-PAGE under reducing conditions.
References & Citations
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
Lentiviral mouse Ccdc171 shRNA (UAS) - Lentiviral mouse Ccdc171 shRNA (UAS, iRFP) (25)
Rabbit anti-Schizosaccharomyces pombe (strain 972/24843)(Fission yeast) SPAC1D4.02c Polyclonal Antibody
Camel Sentrin-Specific Protease 2 (SENP2) ELISA Kit