IL-15, Rhesus macaque (P.pastoris, His)
The IL-15 protein is a cytokine that plays a key role in inflammatory and protective immune responses by regulating innate and adaptive immune cells. It stimulates the proliferation of natural killer cells, T cells and B cells, and promotes the secretion of cytokines. IL-15 Protein, Rhesus macaque (P.pastoris, His) is the recombinant Rhesus Macaque-derived IL-15 protein, expressed by P. pastoris , with N-6*His labeled tag.
Product Specifications
Product Name Alternative
IL-15 Protein, Rhesus macaque (P.pastoris, His), Rhesus Macaque, P. pastoris
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/il-15-protein-rhesus-macaque-p-pastoris-his.html
Purity
90.00
Smiles
NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISHESGDTDIHDTVENLIILANNILSSNGNITESGCKECEELEEKNIKEFLQSFVHIVQMFINTS
Molecular Formula
699616 (Gene_ID) P48092 (N49-S162) (Accession)
Molecular Weight
Approximately 14-18 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
HRP-Linked Polyclonal Antibody to Sex Hormone Binding Globulin (SHBG)
HRP-Linked Polyclonal Antibody to Sex Hormone Binding Globulin (SHBG)
HRP-Linked Polyclonal Antibody to Sex Hormone Binding Globulin (SHBG)
HRP-Linked Polyclonal Antibody to Sex Hormone Binding Globulin (SHBG)
HRP-Linked Polyclonal Antibody to Sex Hormone Binding Globulin (SHBG)