Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

L-selectin/CD62L, Human (HEK293, His)

The L-selectin/CD62L protein is a calcium-dependent lectin that promotes cell adhesion by binding to glycoproteins on neighboring cells. L-selectin/CD62L Protein, Human (HEK293, His) is the recombinant human-derived L-selectin/CD62L protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

L-selectin/CD62L Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/l-selectin-cd62l-protein-human-332a-a-hek293-his.html

Purity

98.0

Smiles

WTYHYSEKPMNWQRARRFCRDNYTDLVAIQNKAEIEYLEKTLPFSRSYYWIGIRKIGGIWTWVGTNKSLTEEAENWGDGEPNNKKNKEDCVEIYIKRNKDAGKWNDDACHKLKAALCYTASCQPWSCSGHGECVEIINNYTCNCDVGYYGPQCQFVIQCEPLEAPELGTMDCTHPLGNFSFSSQCAFSCSEGTNLTGIEETTCGPFGNWSSPEPTCQVIQCEPLSAPDLGIMNCSHPLASFSFTSACTFICSEGTELIGKKKTICESSGIWSNPSPICQKLDKSFSMIKEGDYN

Molecular Formula

6402 (Gene_ID) P14151 (W39-N332) (Accession)

Molecular Weight

50-75 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Erich1 sgRNA CRISPR Lentivector set (Rat)
K6130101 3x 1.0 µg

Erich1 sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
PPARGC1A ORF Vector (Human) (pORF)
ORF028109 1.0 µg DNA

PPARGC1A ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
NFAM1 Antibody
orb2680181-01 50 µL

NFAM1 Antibody

Sign In for Pricing
View Details
NFAM1 Antibody
orb2680181-02 100 µL

NFAM1 Antibody

Sign In for Pricing
View Details
NFAM1 Antibody
orb2680181-03 200 µL

NFAM1 Antibody

Sign In for Pricing
View Details
CNO6L, CT (CNOT6L, CCR4B, CCR4-NOT transcription complex subunit 6-like, Carbon catabolite repressor protein 4 homolog B) (MaxLight 490)
MBS6287268-01 0.1 mL

CNO6L, CT (CNOT6L, CCR4B, CCR4-NOT transcription complex subunit 6-like, Carbon catabolite repressor protein 4 homolog B) (MaxLight 490)

Sign In for Pricing
View Details