Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EpCAM/TROP1, Mouse (HEK293, His)

The EpCAM/TROP1 protein serves as a multifunctional molecule that promotes homogeneous interactions between intestinal epithelial cells (IECs) and intraepithelial lymphocytes (IELs) in the mucosal epithelium. This suggests a crucial role in establishing an immune barrier against mucosal infection. EpCAM/TROP1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived EpCAM/TROP1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

EpCAM/TROP1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/epcam-trop1-protein-mouse-hek293-his.html

Purity

95.0

Smiles

QRDCVCDNYKLATSCSLNEYGECQCTSYGTQNTVICSKLASKCLAMKAEMTHSKSGRRIKPEGAIQNNDGLYDPDCDEQGLFKAKQCNGTATCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKERESPYDHQSLQTALQEAFTSRYKLNQKFIKNIMYENNVITIDLMQNSSQKTQDDVDIADVAYYFEKDVKGESLFHSSKSMDLRVNGEPLDLDPGQTLIYYVDEKAPEFSMQGLT

Molecular Formula

17075 (Gene_ID) Q99JW5/AAH05618.1 (Q24-T266) (Accession)

Molecular Weight

30-38 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Thymidine Kinase 1 Recombinant Antibody, PE Conjugated
bsm-52813R-PE-01 20 µL

Thymidine Kinase 1 Recombinant Antibody, PE Conjugated

Sign In for Pricing
View Details
Thymidine Kinase 1 Recombinant Antibody, PE Conjugated
bsm-52813R-PE-02 100 µL

Thymidine Kinase 1 Recombinant Antibody, PE Conjugated

Sign In for Pricing
View Details
Anti-Glutathione S-transferase A1 GSTA1 Antibody
A01462 100 µL

Anti-Glutathione S-transferase A1 GSTA1 Antibody

Sign In for Pricing
View Details
Recombinant Mycobacterium smegmatis DNA protection during starvation protein (dps)
MBS9423633-01 0.02 mg

Recombinant Mycobacterium smegmatis DNA protection during starvation protein (dps)

Sign In for Pricing
View Details
Recombinant Mycobacterium smegmatis DNA protection during starvation protein (dps)
MBS9423633-02 0.1 mg

Recombinant Mycobacterium smegmatis DNA protection during starvation protein (dps)

Sign In for Pricing
View Details
Recombinant Mycobacterium smegmatis DNA protection during starvation protein (dps)
MBS9423633-03 1 mg

Recombinant Mycobacterium smegmatis DNA protection during starvation protein (dps)

Sign In for Pricing
View Details